Metalloproteinase inhibitor 1


NameMetalloproteinase inhibitor 1
SynonymsCLGI Collagenase inhibitor EPA Erythroid-potentiating activity Fibroblast collagenase inhibitor TIMP TIMP-1 Tissue inhibitor of metalloproteinases 1
Gene NameTIMP1
OrganismHuman
Amino acid sequence
>lcl|BSEQ0019751|Metalloproteinase inhibitor 1
MAPFEPLASGILLLLWLIAPSRACTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQR
YEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHIT
TCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEK
GFQSRHLACLPREPGLCTWQSLRSQIA
Number of residues207
Molecular Weight23170.64
Theoretical pINone
GO Classification
Functions
    cytokine activity
    metal ion binding
    protease binding
    metalloendopeptidase inhibitor activity
Processes
    response to cytokine
    extracellular matrix disassembly
    response to hormone
    extracellular matrix organization
    blood coagulation
    response to peptide hormone
    cartilage development
    negative regulation of apoptotic process
    negative regulation of membrane protein ectodomain proteolysis
    regulation of integrin-mediated signaling pathway
    platelet degranulation
    negative regulation of metalloenzyme activity
    positive regulation of cell proliferation
    negative regulation of trophoblast cell migration
    platelet activation
    negative regulation of endopeptidase activity
    aging
Components
    extracellular exosome
    proteinaceous extracellular matrix
    extracellular region
    platelet alpha granule lumen
    extracellular space
    basement membrane
General FunctionProtease binding
Specific FunctionMetalloproteinase inhibitor that functions by forming one to one complexes with target metalloproteinases, such as collagenases, and irreversibly inactivates them by binding to their catalytic zinc cofactor. Acts on MMP1, MMP2, MMP3, MMP7, MMP8, MMP9, MMP10, MMP11, MMP12, MMP13 and MMP16. Does not act on MMP14. Also functions as a growth factor that regulates cell differentiation, migration and cell death and activates cellular signaling cascades via CD63 and ITGB1. Plays a role in integrin signaling. Mediates erythropoiesis in vitro; but, unlike IL3, it is species-specific, stimulating the growth and differentiation of only human and murine erythroid progenitors.
Transmembrane Regions
GenBank Protein ID
UniProtKB IDP01033
UniProtKB Entry NameTIMP1_HUMAN
Cellular LocationSecreted
Gene sequence
>lcl|BSEQ0019752|Metalloproteinase inhibitor 1 (TIMP1)
ATGGCCCCCTTTGAGCCCCTGGCTTCTGGCATCCTGTTGTTGCTGTGGCTGATAGCCCCC
AGCAGGGCCTGCACCTGTGTCCCACCCCACCCACAGACGGCCTTCTGCAATTCCGACCTC
GTCATCAGGGCCAAGTTCGTGGGGACACCAGAAGTCAACCAGACCACCTTATACCAGCGT
TATGAGATCAAGATGACCAAGATGTATAAAGGGTTCCAAGCCTTAGGGGATGCCGCTGAC
ATCCGGTTCGTCTACACCCCCGCCATGGAGAGTGTCTGCGGATACTTCCACAGGTCCCAC
AACCGCAGCGAGGAGTTTCTCATTGCTGGAAAACTGCAGGATGGACTCTTGCACATCACT
ACCTGCAGTTTTGTGGCTCCCTGGAACAGCCTGAGCTTAGCTCAGCGCCGGGGCTTCACC
AAGACCTACACTGTTGGCTGTGAGGAATGCACAGTGTTTCCCTGTTTATCCATCCCCTGC
AAACTGCAGAGTGGCACTCATTGCTTGTGGACGGACCAGCTCCTCCAAGGCTCTGAAAAG
GGCTTCCAGTCCCGTCACCTTGCCTGCCTGCCTCGGGAGCCAGGGCTGTGCACCTGGCAG
TCCCTGCGGTCCCAGATAGCCTGA
GenBank Gene ID
GeneCard IDNone
GenAtlas ID
HGNC IDHGNC:11820
Chromosome LocationX
LocusNone
References
  1. Docherty AJ, Lyons A, Smith BJ, Wright EM, Stephens PE, Harris TJ, Murphy G, Reynolds JJ: Sequence of human tissue inhibitor of metalloproteinases and its identity to erythroid-potentiating activity. Nature. 1985 Nov 7-13;318(6041):66-9.[3903517 ]
  2. Gasson JC, Golde DW, Kaufman SE, Westbrook CA, Hewick RM, Kaufman RJ, Wong GG, Temple PA, Leary AC, Brown EL, et al.: Molecular characterization and expression of the gene encoding human erythroid-potentiating activity. Nature. 1985 Jun 27-Jul 3;315(6022):768-71.[3839290 ]
  3. Carmichael DF, Sommer A, Thompson RC, Anderson DC, Smith CG, Welgus HG, Stricklin GP: Primary structure and cDNA cloning of human fibroblast collagenase inhibitor. Proc Natl Acad Sci U S A. 1986 Apr;83(8):2407-11.[3010309 ]
  4. Rapp G, Freudenstein J, Klaudiny J, Mucha J, Wempe F, Zimmer M, Scheit KH: Characterization of three abundant mRNAs from human ovarian granulosa cells. DNA Cell Biol. 1990 Sep;9(7):479-85.[2171551 ]
  5. Opbroek A, Kenney MC, Brown D: Characterization of a human corneal metalloproteinase inhibitor (TIMP-1). Curr Eye Res. 1993 Oct;12(10):877-83.[7507419 ]
  6. Hardcastle AJ, Thiselton DL, Nayudu M, Hampson RM, Bhattacharya SS: Genomic organization of the human TIMP-1 gene. Investigation of a causative role in the pathogenesis of X-linked retinitis pigmentosa 2. Invest Ophthalmol Vis Sci. 1997 Aug;38(9):1893-6.[9286280 ]
  7. Osthues A, Knauper V, Oberhoff R, Reinke H, Tschesche H: Isolation and characterization of tissue inhibitors of metalloproteinases (TIMP-1 and TIMP-2) from human rheumatoid synovial fluid. FEBS Lett. 1992 Jan 13;296(1):16-20.[1730286 ]
  8. Van Ranst M, Norga K, Masure S, Proost P, Vandekerckhove F, Auwerx J, Van Damme J, Opdenakker G: The cytokine-protease connection: identification of a 96-kD THP-1 gelatinase and regulation by interleukin-1 and cytokine inducers. Cytokine. 1991 May;3(3):231-9.[1653055 ]
  9. Zhang Z, Henzel WJ: Signal peptide prediction based on analysis of experimentally verified cleavage sites. Protein Sci. 2004 Oct;13(10):2819-24. Epub 2004 Aug 31.[15340161 ]
  10. Williamson RA, Marston FA, Angal S, Koklitis P, Panico M, Morris HR, Carne AF, Smith BJ, Harris TJ, Freedman RB: Disulphide bond assignment in human tissue inhibitor of metalloproteinases (TIMP). Biochem J. 1990 Jun 1;268(2):267-74.[2163605 ]
  11. O'Shea M, Willenbrock F, Williamson RA, Cockett MI, Freedman RB, Reynolds JJ, Docherty AJ, Murphy G: Site-directed mutations that alter the inhibitory activity of the tissue inhibitor of metalloproteinases-1: importance of the N-terminal region between cysteine 3 and cysteine 13. Biochemistry. 1992 Oct 27;31(42):10146-52.[1420137 ]
  12. Chesler L, Golde DW, Bersch N, Johnson MD: Metalloproteinase inhibition and erythroid potentiation are independent activities of tissue inhibitor of metalloproteinases-1. Blood. 1995 Dec 15;86(12):4506-15.[8541540 ]
  13. Knauper V, Lopez-Otin C, Smith B, Knight G, Murphy G: Biochemical characterization of human collagenase-3. J Biol Chem. 1996 Jan 19;271(3):1544-50.[8576151 ]
  14. Knauper V, Cowell S, Smith B, Lopez-Otin C, O'Shea M, Morris H, Zardi L, Murphy G: The role of the C-terminal domain of human collagenase-3 (MMP-13) in the activation of procollagenase-3, substrate specificity, and tissue inhibitor of metalloproteinase interaction. J Biol Chem. 1997 Mar 21;272(12):7608-16.[9065415 ]
  15. Liu T, Qian WJ, Gritsenko MA, Camp DG 2nd, Monroe ME, Moore RJ, Smith RD: Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry. J Proteome Res. 2005 Nov-Dec;4(6):2070-80.[16335952 ]
  16. Jung KK, Liu XW, Chirco R, Fridman R, Kim HR: Identification of CD63 as a tissue inhibitor of metalloproteinase-1 interacting cell surface protein. EMBO J. 2006 Sep 6;25(17):3934-42. Epub 2006 Aug 17.[16917503 ]
  17. Lewandrowski U, Moebius J, Walter U, Sickmann A: Elucidation of N-glycosylation sites on human platelet proteins: a glycoproteomic approach. Mol Cell Proteomics. 2006 Feb;5(2):226-33. Epub 2005 Oct 31.[16263699 ]
  18. Jia W, Lu Z, Fu Y, Wang HP, Wang LH, Chi H, Yuan ZF, Zheng ZB, Song LN, Han HH, Liang YM, Wang JL, Cai Y, Zhang YK, Deng YL, Ying WT, He SM, Qian XH: A strategy for precise and large scale identification of core fucosylated glycoproteins. Mol Cell Proteomics. 2009 May;8(5):913-23. doi: 10.1074/mcp.M800504-MCP200. Epub 2009 Jan 12.[19139490 ]
  19. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17.[21269460 ]
  20. Rosenow A, Noben JP, Jocken J, Kallendrusch S, Fischer-Posovszky P, Mariman EC, Renes J: Resveratrol-induced changes of the human adipocyte secretion profile. J Proteome Res. 2012 Sep 7;11(9):4733-43. doi: 10.1021/pr300539b. Epub 2012 Aug 27.[22905912 ]
  21. Toricelli M, Melo FH, Peres GB, Silva DC, Jasiulionis MG: Timp1 interacts with beta-1 integrin and CD63 along melanoma genesis and confers anoikis resistance by activating PI3-K signaling pathway independently of Akt phosphorylation. Mol Cancer. 2013 Mar 25;12:22. doi: 10.1186/1476-4598-12-22.[23522389 ]
  22. Lee SY, Kim JM, Cho SY, Kim HS, Shin HS, Jeon JY, Kausar R, Jeong SY, Lee YS, Lee MA: TIMP-1 modulates chemotaxis of human neural stem cells through CD63 and integrin signalling. Biochem J. 2014 May 1;459(3):565-76. doi: 10.1042/BJ20131119.[24635319 ]
  23. Ries C: Cytokine functions of TIMP-1. Cell Mol Life Sci. 2014 Feb;71(4):659-72. doi: 10.1007/s00018-013-1457-3. Epub 2013 Aug 28.[23982756 ]
  24. Tagliabracci VS, Wiley SE, Guo X, Kinch LN, Durrant E, Wen J, Xiao J, Cui J, Nguyen KB, Engel JL, Coon JJ, Grishin N, Pinna LA, Pagliarini DJ, Dixon JE: A Single Kinase Generates the Majority of the Secreted Phosphoproteome. Cell. 2015 Jun 18;161(7):1619-32. doi: 10.1016/j.cell.2015.05.028.[26091039 ]
  25. Gomis-Ruth FX, Maskos K, Betz M, Bergner A, Huber R, Suzuki K, Yoshida N, Nagase H, Brew K, Bourenkov GP, Bartunik H, Bode W: Mechanism of inhibition of the human matrix metalloproteinase stromelysin-1 by TIMP-1. Nature. 1997 Sep 4;389(6646):77-81.[9288970 ]
  26. Wu B, Arumugam S, Gao G, Lee GI, Semenchenko V, Huang W, Brew K, Van Doren SR: NMR structure of tissue inhibitor of metalloproteinases-1 implicates localized induced fit in recognition of matrix metalloproteinases. J Mol Biol. 2000 Jan 14;295(2):257-68.[10623524 ]
  27. Arumugam S, Van Doren SR: Global orientation of bound MMP-3 and N-TIMP-1 in solution via residual dipolar couplings. Biochemistry. 2003 Jul 8;42(26):7950-8.[12834347 ]
  28. Iyer S, Wei S, Brew K, Acharya KR: Crystal structure of the catalytic domain of matrix metalloproteinase-1 in complex with the inhibitory domain of tissue inhibitor of metalloproteinase-1. J Biol Chem. 2007 Jan 5;282(1):364-71. Epub 2006 Oct 18.[17050530 ]
  29. Grossman M, Tworowski D, Dym O, Lee MH, Levy Y, Murphy G, Sagi I: The intrinsic protein flexibility of endogenous protease inhibitor TIMP-1 controls its binding interface and affects its function. Biochemistry. 2010 Jul 27;49(29):6184-92. doi: 10.1021/bi902141x.[20545310 ]
  30. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7.[15489334 ]
  31. Ramachandran P, Boontheung P, Xie Y, Sondej M, Wong DT, Loo JA: Identification of N-linked glycoproteins in human saliva by glycoprotein capture and mass spectrometry. J Proteome Res. 2006 Jun;5(6):1493-503.[16740002 ]
  32. Batra J, Robinson J, Soares AS, Fields AP, Radisky DC, Radisky ES: Matrix metalloproteinase-10 (MMP-10) interaction with tissue inhibitors of metalloproteinases TIMP-1 and TIMP-2: binding studies and crystal structure. J Biol Chem. 2012 May 4;287(19):15935-46. doi: 10.1074/jbc.M112.341156. Epub 2012 Mar 16.[22427646 ]

Related FRC


FRCD ID Name Exact Mass Structure



Mevinphos




224.15



Niclosamide




327.117



Spiroxamine




297.483



Thidiazuron




220.25



Triclosan




289.536



Rotenone




394.423