Ig alpha-2 chain C region


NameIg alpha-2 chain C region
Synonyms
Gene NameIGHA2
OrganismHuman
Amino acid sequence
>lcl|BSEQ0009530|Ig alpha-2 chain C region
ASPTSPKVFPLSLDSTPQDGNVVVACLVQGFFPQEPLSVTWSESGQNVTARNFPPSQDAS
GDLYTTSSQLTLPATQCPDGKSVTCHVKHYTNPSQDVTVPCPVPPPPPCCHPRLSLHRPA
LEDLLLGSEANLTCTLTGLRDASGATFTWTPSSGKSAVQGPPERDLCGCYSVSSVLPGCA
QPWNHGETFTCTAAHPELKTPLTANITKSGNTFRPEVHLLPPPSEELALNELVTLTCLAR
GFSPKDVLVRWLQGSQELPREKYLTWASRQEPSQGTTTFAVTSILRVAAEDWKKGDTFSC
MVGHEALPLAFTQKTIDRMAGKPTHVNVSVVMAEVDGTCY
Number of residues340
Molecular Weight36526.005
Theoretical pINone
GO Classification
Functions
    antigen binding
Processes
    receptor-mediated endocytosis
    phagocytosis, engulfment
    retina homeostasis
    positive regulation of respiratory burst
    immune response
    B cell receptor signaling pathway
    antibacterial humoral response
    complement activation, classical pathway
    Fc-gamma receptor signaling pathway involved in phagocytosis
    innate immune response
    phagocytosis, recognition
    positive regulation of B cell activation
    Fc-epsilon receptor signaling pathway
    glomerular filtration
Components
    monomeric IgA immunoglobulin complex
    blood microparticle
    secretory dimeric IgA immunoglobulin complex
    secretory IgA immunoglobulin complex
    extracellular region
    extracellular space
    extracellular exosome
    external side of plasma membrane
General FunctionAntigen binding
Specific FunctionIg alpha is the major immunoglobulin class in body secretions. It may serve both to defend against local infection and to prevent access of foreign antigens to the general immunologic system.
Transmembrane Regions
GenBank Protein ID
UniProtKB IDP01877
UniProtKB Entry NameIGHA2_HUMAN
Cellular LocationNone
Gene sequence
None
GenBank Gene ID
GeneCard IDNone
GenAtlas ID
HGNC IDHGNC:5479
Chromosome LocationNone
LocusNone
References
  1. Flanagan JG, Lefranc MP, Rabbitts TH: Mechanisms of divergence and convergence of the human immunoglobulin alpha 1 and alpha 2 constant region gene sequences. Cell. 1984 Mar;36(3):681-8.[6421489 ]
  2. Torano A, Putnam FW: Complete amino acid sequence of the alpha 2 heavy chain of a human IgA2 immunoglobulin of the A2m (2) allotype. Proc Natl Acad Sci U S A. 1978 Feb;75(2):966-9.[416441 ]
  3. Tsuzukida Y, Wang CC, Putnam FW: Structure of the A2m(1) allotype of human IgA--a recombinant molecule. Proc Natl Acad Sci U S A. 1979 Mar;76(3):1104-8.[286295 ]
  4. Kerr MA: The structure and function of human IgA. Biochem J. 1990 Oct 15;271(2):285-96.[2241915 ]
  5. Kristiansen TZ, Bunkenborg J, Gronborg M, Molina H, Thuluvath PJ, Argani P, Goggins MG, Maitra A, Pandey A: A proteomic analysis of human bile. Mol Cell Proteomics. 2004 Jul;3(7):715-28. Epub 2004 Apr 14.[15084671 ]
  6. Bunkenborg J, Pilch BJ, Podtelejnikov AV, Wisniewski JR: Screening for N-glycosylated proteins by liquid chromatography mass spectrometry. Proteomics. 2004 Feb;4(2):454-65.[14760718 ]
  7. Ramachandran P, Boontheung P, Xie Y, Sondej M, Wong DT, Loo JA: Identification of N-linked glycoproteins in human saliva by glycoprotein capture and mass spectrometry. J Proteome Res. 2006 Jun;5(6):1493-503.[16740002 ]
  8. Picariello G, Ferranti P, Mamone G, Roepstorff P, Addeo F: Identification of N-linked glycoproteins in human milk by hydrophilic interaction liquid chromatography and mass spectrometry. Proteomics. 2008 Sep;8(18):3833-47. doi: 10.1002/pmic.200701057.[18780401 ]
  9. Jia W, Lu Z, Fu Y, Wang HP, Wang LH, Chi H, Yuan ZF, Zheng ZB, Song LN, Han HH, Liang YM, Wang JL, Cai Y, Zhang YK, Deng YL, Ying WT, He SM, Qian XH: A strategy for precise and large scale identification of core fucosylated glycoproteins. Mol Cell Proteomics. 2009 May;8(5):913-23. doi: 10.1074/mcp.M800504-MCP200. Epub 2009 Jan 12.[19139490 ]
  10. Heilig R, Eckenberg R, Petit JL, Fonknechten N, Da Silva C, Cattolico L, Levy M, Barbe V, de Berardinis V, Ureta-Vidal A, Pelletier E, Vico V, Anthouard V, Rowen L, Madan A, Qin S, Sun H, Du H, Pepin K, Artiguenave F, Robert C, Cruaud C, Bruls T, Jaillon O, Friedlander L, Samson G, Brottier P, Cure S, Segurens B, Aniere F, Samain S, Crespeau H, Abbasi N, Aiach N, Boscus D, Dickhoff R, Dors M, Dubois I, Friedman C, Gouyvenoux M, James R, Madan A, Mairey-Estrada B, Mangenot S, Martins N, Menard M, Oztas S, Ratcliffe A, Shaffer T, Trask B, Vacherie B, Bellemere C, Belser C, Besnard-Gonnet M, Bartol-Mavel D, Boutard M, Briez-Silla S, Combette S, Dufosse-Laurent V, Ferron C, Lechaplais C, Louesse C, Muselet D, Magdelenat G, Pateau E, Petit E, Sirvain-Trukniewicz P, Trybou A, Vega-Czarny N, Bataille E, Bluet E, Bordelais I, Dubois M, Dumont C, Guerin T, Haffray S, Hammadi R, Muanga J, Pellouin V, Robert D, Wunderle E, Gauguet G, Roy A, Sainte-Marthe L, Verdier J, Verdier-Discala C, Hillier L, Fulton L, McPherson J, Matsuda F, Wilson R, Scarpelli C, Gyapay G, Wincker P, Saurin W, Quetier F, Waterston R, Hood L, Weissenbach J: The DNA sequence and analysis of human chromosome 14. Nature. 2003 Feb 6;421(6923):601-7. Epub 2003 Jan 1.[12508121 ]

Related FRC


FRCD ID Name Exact Mass Structure



Cyanocobalamin




1356.396



Cobaltocene




189.123



Adenosylcobalamin




1579.608



Methylcobalamin




1344.405



Hydroxocobalamin




1346.377



Salcomine




327.249