Platelet factor 4

NamePlatelet factor 4
SynonymsC-X-C motif chemokine 4 CXCL4 Iroplact Oncostatin-A PF-4 SCYB4
Gene NamePF4
OrganismHuman
Amino acid sequence
>lcl|BSEQ0010788|Platelet factor 4
MSSAAGFCASRPGLLFLGLLLLPLVVAFASAEAEEDGDLQCLCVKTTSQVRPRHITSLEV
IKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES
Number of residues101
Molecular Weight10844.78
Theoretical pI8.78
GO Classification
Functions
    CXCR3 chemokine receptor binding
chemokine activity
heparin binding
Processes
    positive regulation of transcription from RNA polymerase II promoter
negative regulation of extrinsic apoptotic signaling pathway in absence of ligand
chemokine-mediated signaling pathway
platelet degranulation
negative regulation of angiogenesis
blood coagulation
G-protein coupled receptor signaling pathway
positive regulation of macrophage differentiation
positive regulation of tumor necrosis factor production
immune response
positive regulation of macrophage derived foam cell differentiation
leukocyte chemotaxis
response to lipopolysaccharide
negative regulation of cytolysis
cytokine-mediated signaling pathway
negative regulation of megakaryocyte differentiation
inflammatory response
positive regulation of gene expression
negative regulation of MHC class II biosynthetic process
platelet activation
positive regulation of cAMP metabolic process
regulation of cell proliferation
positive regulation of cAMP-mediated signaling
positive regulation of leukocyte chemotaxis
Components
    platelet alpha granule lumen
extracellular region
extracellular space
General FunctionHeparin binding
Specific FunctionReleased during platelet aggregation. Neutralizes the anticoagulant effect of heparin because it binds more strongly to heparin than to the chondroitin-4-sulfate chains of the carrier molecule. Chemotactic for neutrophils and monocytes. Inhibits endothelial cell proliferation, the short form is a more potent inhibitor than the longer form.
Transmembrane Regions
GenBank Protein ID189851
UniProtKB IDP02776
UniProtKB Entry NamePLF4_HUMAN
Cellular LocationSecreted
Gene sequence
>lcl|BSEQ0010789|Platelet factor 4 (PF4)
ATGAGCTCCGCAGCCGGGTTCTGCGCCTCACGCCCCGGGCTGCTGTTCCTGGGGTTGCTG
CTCCTGCCACTTGTGGTCGCCTTCGCCAGCGCTGAAGCTGAAGAAGATGGGGACCTGCAG
TGCCTGTGTGTGAAGACCACCTCCCAGGTCCGTCCCAGGCACATCACCAGCCTGGAGGTG
ATCAAGGCCGGACCCCACTGCCCCACTGCCCAACTGATAGCCACGCTGAAGAATGGAAGG
AAAATTTGCTTGGACCTGCAAGCCCCGCTGTACAAGAAAATAATTAAGAAACTTTTGGAG
AGTTAG
GenBank Gene IDM25897
GeneCard IDNone
GenAtlas IDPF4
HGNC IDHGNC:8861
Chromosome Location4
Locus4q12-q21
References
  1. Poncz M, Surrey S, LaRocco P, Weiss MJ, Rappaport EF, Conway TM, Schwartz E: Cloning and characterization of platelet factor 4 cDNA derived from a human erythroleukemic cell line. Blood. 1987 Jan;69(1):219-23.[3098319 ]
  2. Eisman R, Surrey S, Ramachandran B, Schwartz E, Poncz M: Structural and functional comparison of the genes for human platelet factor 4 and PF4alt. Blood. 1990 Jul 15;76(2):336-44.[1695112 ]
  3. Zhang C, Thornton MA, Kowalska MA, Sachis BS, Feldman M, Poncz M, McKenzie SE, Reilly MP: Localization of distal regulatory domains in the megakaryocyte-specific platelet basic protein/platelet factor 4 gene locus. Blood. 2001 Aug 1;98(3):610-7.[11468158 ]
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7.[15489334 ]
  5. Hermodson M, Schmer G, Kurachi K: Isolation, crystallization, and primary amino acid sequence of human platelet factor 4. J Biol Chem. 1977 Sep 25;252(18):6276-9.[893407 ]
  6. Deuel TF, Keim PS, Farmer M, Heinrikson RL: Amino acid sequence of human platelet factor 4. Proc Natl Acad Sci U S A. 1977 Jun;74(6):2256-8.[267922 ]
  7. Walz DA, Wu VY, de Lamo R, Dene H, McCoy LE: Primary structure of human platelet factor 4. Thromb Res. 1977 Dec;11(6):893-8.[601757 ]
  8. Morgan FJ, Begg GS, Chesterman CN: Complete covalent structure of human platelet factor 4. Thromb Haemost. 1980 Feb 29;42(5):1652-60.[6445090 ]
  9. Gupta SK, Hassel T, Singh JP: A potent inhibitor of endothelial cell proliferation is generated by proteolytic cleavage of the chemokine platelet factor 4. Proc Natl Acad Sci U S A. 1995 Aug 15;92(17):7799-803.[7644496 ]
  10. Kuo JH, Chen YP, Liu JS, Dubrac A, Quemener C, Prats H, Bikfalvi A, Wu WG, Sue SC: Alternative C-terminal helix orientation alters chemokine function: structure of the anti-angiogenic chemokine, CXCL4L1. J Biol Chem. 2013 May 10;288(19):13522-33. doi: 10.1074/jbc.M113.455329. Epub 2013 Mar 27.[23536183 ]
  11. Zhang X, Chen L, Bancroft DP, Lai CK, Maione TE: Crystal structure of recombinant human platelet factor 4. Biochemistry. 1994 Jul 12;33(27):8361-6.[8031770 ]
  12. Mayo KH, Roongta V, Ilyina E, Milius R, Barker S, Quinlan C, La Rosa G, Daly TJ: NMR solution structure of the 32-kDa platelet factor 4 ELR-motif N-terminal chimera: a symmetric tetramer. Biochemistry. 1995 Sep 12;34(36):11399-409.[7547867 ]
  13. Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M, Becker MC, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Kremitzki C, Oddy L, Du H, Sun H, Bradshaw-Cordum H, Ali J, Carter J, Cordes M, Harris A, Isak A, van Brunt A, Nguyen C, Du F, Courtney L, Kalicki J, Ozersky P, Abbott S, Armstrong J, Belter EA, Caruso L, Cedroni M, Cotton M, Davidson T, Desai A, Elliott G, Erb T, Fronick C, Gaige T, Haakenson W, Haglund K, Holmes A, Harkins R, Kim K, Kruchowski SS, Strong CM, Grewal N, Goyea E, Hou S, Levy A, Martinka S, Mead K, McLellan MD, Meyer R, Randall-Maher J, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Shah N, Swearengen-Shahid S, Snider J, Strong JT, Thompson J, Yoakum M, Leonard S, Pearman C, Trani L, Radionenko M, Waligorski JE, Wang C, Rock SM, Tin-Wollam AM, Maupin R, Latreille P, Wendl MC, Yang SP, Pohl C, Wallis JW, Spieth J, Bieri TA, Berkowicz N, Nelson JO, Osborne J, Ding L, Meyer R, Sabo A, Shotland Y, Sinha P, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Jones TA, She X, Ciccarelli FD, Izaurralde E, Taylor J, Schmutz J, Myers RM, Cox DR, Huang X, McPherson JD, Mardis ER, Clifton SW, Warren WC, Chinwalla AT, Eddy SR, Marra MA, Ovcharenko I, Furey TS, Miller W, Eichler EE, Bork P, Suyama M, Torrents D, Waterston RH, Wilson RK: Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Nature. 2005 Apr 7;434(7034):724-31.[15815621 ]

Related FRC

FRCD ID Name Exact Mass Structure




F04718



Heparin


340.31