Protein S100-B
| Name | Protein S100-B |
|---|---|
| Synonyms | S-100 protein beta chain S-100 protein subunit beta S100 calcium-binding protein B |
| Gene Name | S100B |
| Organism | Human |
| Amino acid sequence | >lcl|BSEQ0010821|Protein S100-B MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMET LDNDGDGECDFQEFMAFVAMVTTACHEFFEHE |
| Number of residues | 92 |
| Molecular Weight | 10712.985 |
| Theoretical pI | 4.25 |
| GO Classification |
Functions
calcium-dependent protein binding S100 protein binding RAGE receptor binding tau protein binding protein homodimerization activity zinc ion binding identical protein binding calcium ion binding Processes
positive regulation of cell proliferation positive regulation of I-kappaB kinase/NF-kappaB signaling response to glucocorticoid axonogenesis regulation of cell shape cell proliferation cellular response to hypoxia memory astrocyte differentiation response to methylmercury negative regulation of skeletal muscle cell differentiation innate immune response central nervous system development regulation of neuronal synaptic plasticity positive regulation of apoptotic process learning or memory long-term synaptic potentiation Components
extracellular region nucleus ruffle extracellular space neuronal cell body perinuclear region of cytoplasm cytoplasm intracellular membrane-bounded organelle |
| General Function | Zinc ion binding |
| Specific Function | Weakly binds calcium but binds zinc very tightly-distinct binding sites with different affinities exist for both ions on each monomer. Physiological concentrations of potassium ion antagonize the binding of both divalent cations, especially affecting high-affinity calcium-binding sites. Binds to and initiates the activation of STK38 by releasing autoinhibitory intramolecular interactions within the kinase. Interaction with AGER after myocardial infarction may play a role in myocyte apoptosis by activating ERK1/2 and p53/TP53 signaling. Could assist ATAD3A cytoplasmic processing, preventing aggregation and favoring mitochondrial localization. May mediate calcium-dependent regulation on many physiological processes by interacting with other proteins, such as TPR-containing proteins, and modulating their activity. |
| Transmembrane Regions | |
| GenBank Protein ID | 337730 |
| UniProtKB ID | P04271 |
| UniProtKB Entry Name | S100B_HUMAN |
| Cellular Location | Cytoplasm |
| Gene sequence | >lcl|BSEQ0010822|Protein S100-B (S100B) ATGTCTGAGCTGGAGAAGGCCATGGTGGCCCTCATCGACGTTTTCCACCAATATTCTGGA AGGGAGGGAGACAAGCACAAGCTGAAGAAATCCGAACTGAAGGAGCTCATCAACAATGAG CTTTCCCATTTCTTAGAGGAAATCAAAGAGCAGGAGGTTGTGGACAAAGTCATGGAAACA CTGGACAATGATGGAGACGGCGAATGTGACTTCCAGGAATTCATGGCCTTTGTTGCCATG GTTACTACTGCCTGCCACGAGTTCTTTGAACATGAGTGA |
| GenBank Gene ID | M59488 |
| GeneCard ID | None |
| GenAtlas ID | S100B |
| HGNC ID | HGNC:10500 |
| Chromosome Location | 21 |
| Locus | None |
| References |
|
Related FRC
| FRCD ID | Name | Exact Mass | Structure |
|---|---|---|---|
Calcium |
40.078 |