Glutathione peroxidase 1


NameGlutathione peroxidase 1
Synonyms1.11.1.9 Cellular glutathione peroxidase GPx-1
Gene NameGPX1
OrganismHuman
Amino acid sequence
>lcl|BSEQ0037083|Glutathione peroxidase 1
MCAARLAAAAAAAQSVYAFSARPLAGGEPVSLGSLRGKVLLIENVASLUGTTVRDYTQMN
ELQRRLGPRGLVVLGFPCNQFGHQENAKNEEILNSLKYVRPGGGFEPNFMLFEKCEVNGA
GAHPLFAFLREALPAPSDDATALMTDPKLITWSPVCRNDVAWNFEKFLVGPDGVPLRRYS
RRFQTIDIEPDIEALLSQGPSCA
Number of residues203
Molecular Weight22087.94
Theoretical pI6.5
GO Classification
Functions
    SH3 domain binding
    phospholipid-hydroperoxide glutathione peroxidase activity
    glutathione binding
    glutathione peroxidase activity
    selenium binding
Processes
    response to glucose
    blood vessel endothelial cell migration
    protein oxidation
    response to toxic substance
    heart contraction
    hydrogen peroxide catabolic process
    regulation of gene expression, epigenetic
    endothelial cell development
    regulation of neuron apoptotic process
    positive regulation of fibril organization
    positive regulation of protein kinase B signaling
    vasodilation
    interaction with symbiont
    arachidonic acid metabolic process
    response to xenobiotic stimulus
    angiogenesis involved in wound healing
    regulation of mammary gland epithelial cell proliferation
    cellular response to oxidative stress
    myoblast proliferation
    lipoxygenase pathway
    skeletal muscle fiber development
    response to folic acid
    response to symbiotic bacterium
    response to estradiol
    negative regulation of release of cytochrome c from mitochondria
    purine nucleotide catabolic process
    negative regulation of inflammatory response to antigenic stimulus
    response to gamma radiation
    response to hydrogen peroxide
    aging
    triglyceride metabolic process
    sensory perception of sound
    fat cell differentiation
    response to selenium ion
    negative regulation of cysteine-type endopeptidase activity involved in apoptotic process
    intrinsic apoptotic signaling pathway in response to oxidative stress
    response to nicotine
    response to reactive oxygen species
    negative regulation of extrinsic apoptotic signaling pathway via death domain receptors
    UV protection
    temperature homeostasis
    cell redox homeostasis
    nucleobase-containing small molecule metabolic process
    regulation of proteasomal protein catabolic process
    glutathione metabolic process
    small molecule metabolic process
    response to lipid hydroperoxide
    skeletal muscle tissue regeneration
    purine nucleobase metabolic process
    negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway
Components
    cytosol
    extracellular exosome
    cytoplasm
    mitochondrion
    nucleus
    mitochondrial matrix
General FunctionSh3 domain binding
Specific FunctionProtects the hemoglobin in erythrocytes from oxidative breakdown.
Transmembrane Regions
GenBank Protein ID577777
UniProtKB IDP07203
UniProtKB Entry NameGPX1_HUMAN
Cellular LocationCytoplasm
Gene sequence
>lcl|BSEQ0020489|Glutathione peroxidase 1 (GPX1)
ATGTGTGCTGCTCGGCTAGCGGCGGCGGCGGCGGCGGCCCAGTCGGTGTATGCCTTCTCG
GCGCGCCCGCTGGCCGGCGGGGAGCCTGTGAGCCTGGGCTCCCTGCGGGGCAAGGTACTA
CTTATCGAGAATGTGGCGTCCCTCTGAGGCACCACGGTCCGGGACTACACCCAGATGAAC
GAGCTGCAGCGGCGCCTCGGACCCCGGGGCCTGGTGGTGCTCGGCTTCCCGTGCAACCAG
TTTGGGCATCAGGAGAACGCCAAGAACGAAGAGATTCTGAATTCCCTCAAGTACGTCCGG
CCTGGTGGTGGGTTCGAGCCCAACTTCATGCTCTTCGAGAAGTGCGAGGTGAACGGTGCG
GGGGCGCACCCTCTCTTCGCCTTCCTGCGGGAGGCCCTGCCAGCTCCCAGCGACGACGCC
ACCGCGCTTATGACCGACCCCAAGCTCATCACCTGGTCTCCGGTGTGTCGCAACGATGTT
GCCTGGAACTTTGAGAAGTTCCTGGTGGGCCCTGACGGTGTGCCCCTACGCAGGTACAGC
CGCCGCTTCCAGACCATTGACATCGAGCCTGACATCGAAGCCCTGCTGTCTCAAGGGCCC
AGCTGTGCCTAG
GenBank Gene IDY00433
GeneCard IDNone
GenAtlas IDGPX1
HGNC IDHGNC:4553
Chromosome Location3
Locus3p21.3
References
  1. Sukenaga Y, Ishida K, Takeda T, Takagi K: cDNA sequence coding for human glutathione peroxidase. Nucleic Acids Res. 1987 Sep 11;15(17):7178.[3658677 ]
  2. Ishida K, Morino T, Takagi K, Sukenaga Y: Nucleotide sequence of a human gene for glutathione peroxidase. Nucleic Acids Res. 1987 Dec 10;15(23):10051.[3697069 ]
  3. Mullenbach GT, Tabrizi A, Irvine BD, Bell GI, Hallewell RA: Sequence of a cDNA coding for human glutathione peroxidase confirms TGA encodes active site selenocysteine. Nucleic Acids Res. 1987 Jul 10;15(13):5484.[2955287 ]
  4. Chada S, Le Beau MM, Casey L, Newburger PE: Isolation and chromosomal localization of the human glutathione peroxidase gene. Genomics. 1990 Feb;6(2):268-71.[2307470 ]
  5. Moscow JA, Morrow CS, He R, Mullenbach GT, Cowan KH: Structure and function of the 5'-flanking sequence of the human cytosolic selenium-dependent glutathione peroxidase gene (hgpx1). J Biol Chem. 1992 Mar 25;267(9):5949-58.[1556108 ]
  6. Muzny DM, Scherer SE, Kaul R, Wang J, Yu J, Sudbrak R, Buhay CJ, Chen R, Cree A, Ding Y, Dugan-Rocha S, Gill R, Gunaratne P, Harris RA, Hawes AC, Hernandez J, Hodgson AV, Hume J, Jackson A, Khan ZM, Kovar-Smith C, Lewis LR, Lozado RJ, Metzker ML, Milosavljevic A, Miner GR, Morgan MB, Nazareth LV, Scott G, Sodergren E, Song XZ, Steffen D, Wei S, Wheeler DA, Wright MW, Worley KC, Yuan Y, Zhang Z, Adams CQ, Ansari-Lari MA, Ayele M, Brown MJ, Chen G, Chen Z, Clendenning J, Clerc-Blankenburg KP, Chen R, Chen Z, Davis C, Delgado O, Dinh HH, Dong W, Draper H, Ernst S, Fu G, Gonzalez-Garay ML, Garcia DK, Gillett W, Gu J, Hao B, Haugen E, Havlak P, He X, Hennig S, Hu S, Huang W, Jackson LR, Jacob LS, Kelly SH, Kube M, Levy R, Li Z, Liu B, Liu J, Liu W, Lu J, Maheshwari M, Nguyen BV, Okwuonu GO, Palmeiri A, Pasternak S, Perez LM, Phelps KA, Plopper FJ, Qiang B, Raymond C, Rodriguez R, Saenphimmachak C, Santibanez J, Shen H, Shen Y, Subramanian S, Tabor PE, Verduzco D, Waldron L, Wang J, Wang J, Wang Q, Williams GA, Wong GK, Yao Z, Zhang J, Zhang X, Zhao G, Zhou J, Zhou Y, Nelson D, Lehrach H, Reinhardt R, Naylor SL, Yang H, Olson M, Weinstock G, Gibbs RA: The DNA sequence, annotation and analysis of human chromosome 3. Nature. 2006 Apr 27;440(7088):1194-8.[16641997 ]
  7. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17.[21269460 ]
  8. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22.[24275569 ]
  9. Vaca Jacome AS, Rabilloud T, Schaeffer-Reiss C, Rompais M, Ayoub D, Lane L, Bairoch A, Van Dorsselaer A, Carapito C: N-terminome analysis of the human mitochondrial proteome. Proteomics. 2015 Jul;15(14):2519-24. doi: 10.1002/pmic.201400617. Epub 2015 Jun 8.[25944712 ]
  10. Forsberg L, de Faire U, Morgenstern R: Low yield of polymorphisms from EST blast searching: analysis of genes related to oxidative stress and verification of the P197L polymorphism in GPX1. Hum Mutat. 1999;13(4):294-300.[10220143 ]
  11. Kote-Jarai Z, Durocher F, Edwards SM, Hamoudi R, Jackson RA, Ardern-Jones A, Murkin A, Dearnaley DP, Kirby R, Houlston R, Easton DF, Eeles R: Association between the GCG polymorphism of the selenium dependent GPX1 gene and the risk of young onset prostate cancer. Prostate Cancer Prostatic Dis. 2002;5(3):189-92.[12496980 ]
  12. Hamanishi T, Furuta H, Kato H, Doi A, Tamai M, Shimomura H, Sakagashira S, Nishi M, Sasaki H, Sanke T, Nanjo K: Functional variants in the glutathione peroxidase-1 (GPx-1) gene are associated with increased intima-media thickness of carotid arteries and risk of macrovascular diseases in japanese type 2 diabetic patients. Diabetes. 2004 Sep;53(9):2455-60.[15331559 ]
  13. Ichimura Y, Habuchi T, Tsuchiya N, Wang L, Oyama C, Sato K, Nishiyama H, Ogawa O, Kato T: Increased risk of bladder cancer associated with a glutathione peroxidase 1 codon 198 variant. J Urol. 2004 Aug;172(2):728-32.[15247771 ]
  14. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7.[15489334 ]

Related FRC


FRCD ID Name Exact Mass Structure



Acetonitrile




41.053



Mandelonitrile




133.15



Acrylonitrile




53.064



Beta-Aminopropionitrile




70.095



Benzonitrile




103.124



Benzeneacetonitrile




117.151



Bromoxynil




276.915



Chlorfenapyr




407.615



Chlorothalonil




265.902



2,6-Dichlorobenzonitrile




172.008



Glutathione




307.321



Acetaminophen




151.165



Cyanide




26.018



Linamarin




247.247