Fibroblast growth factor 2

NameFibroblast growth factor 2
SynonymsBasic fibroblast growth factor bFGF FGF-2 FGFB HBGF-2 Heparin-binding growth factor 2
Gene NameFGF2
OrganismHuman
Amino acid sequence
>lcl|BSEQ0037112|Fibroblast growth factor 2
MVGVGGGDVEDVTPRPGGCQISGRGARGCNGIPGAAAWEAALPRRRPRRHPSVNPRSRAA
GSPRTRGRRTEERPSGSRLGDRGRGRALPGGRLGGRGRGRAPERVGGRGRGRGTAAPRAA
PAARGSRPGPAGTMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDG
RVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERL
ESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Number of residues288
Molecular Weight30769.715
Theoretical pI10.01
GO Classification
Functions
    ligand-dependent nuclear receptor transcription coactivator activity
cytokine activity
heparin binding
chemoattractant activity
fibroblast growth factor receptor binding
growth factor activity
Processes
    activation of MAPKK activity
positive regulation of cell proliferation
inositol phosphate biosynthetic process
organ morphogenesis
fibroblast growth factor receptor signaling pathway
positive chemotaxis
positive regulation of MAP kinase activity
positive regulation of cell fate specification
insulin receptor signaling pathway
hyaluronan catabolic process
phosphatidylinositol-mediated signaling
positive regulation of endothelial cell chemotaxis to fibroblast growth factor
small GTPase mediated signal transduction
chondroblast differentiation
MAPK cascade
branching involved in ureteric bud morphogenesis
positive regulation of ERK1 and ERK2 cascade
positive regulation of sprouting angiogenesis
chemotaxis
positive regulation of cell division
neurotrophin TRK receptor signaling pathway
positive regulation of phosphatidylinositol 3-kinase activity
axon guidance
regulation of endothelial cell chemotaxis to fibroblast growth factor
positive regulation of transcription from RNA polymerase II promoter
phosphatidylinositol biosynthetic process
positive regulation of phospholipase C activity
epidermal growth factor receptor signaling pathway
embryonic morphogenesis
positive regulation of blood vessel endothelial cell migration
Ras protein signal transduction
regulation of angiogenesis
innate immune response
negative regulation of blood vessel endothelial cell migration
cell migration involved in sprouting angiogenesis
somatic stem cell population maintenance
signal transduction
negative regulation of wound healing
Fc-epsilon receptor signaling pathway
release of sequestered calcium ion into cytosol
negative regulation of fibroblast migration
vascular endothelial growth factor receptor signaling pathway
positive regulation of angiogenesis
extracellular matrix organization
negative regulation of cell death
wound healing
activation of MAPK activity
positive regulation of transcription, DNA-templated
positive regulation of cardiac muscle cell proliferation
nervous system development
growth factor dependent regulation of skeletal muscle satellite cell proliferation
positive regulation of endothelial cell proliferation
Components
    extracellular space
extracellular region
nucleus
General FunctionLigand-dependent nuclear receptor transcription coactivator activity
Specific FunctionPlays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro.
Transmembrane Regions
GenBank Protein ID31362
UniProtKB IDP09038
UniProtKB Entry NameFGF2_HUMAN
Cellular LocationSecreted
Gene sequence
>lcl|BSEQ0021843|Fibroblast growth factor 2 (FGF2)
CTGGTGGGTGTGGGGGGTGGAGATGTAGAAGATGTGACGCCGCGGCCCGGCGGGTGCCAG
ATTAGCGGACGCGGTGCCCGCGGTTGCAACGGGATCCCGGGCGCTGCAGCTTGGGAGGCG
GCTCTCCCCAGGCGGCGTCCGCGGAGACACCCATCCGTGAACCCCAGGTCCCGGGCCGCC
GGCTCGCCGCGCACCAGGGGCCGGCGGACAGAAGAGCGGCCGAGCGGCTCGAGGCTGGGG
GACCGCGGGCGCGGCCGCGCGCTGCCGGGCGGGAGGCTGGGGGGCCGGGGCCGGGGCCGT
GCCCCGGAGCGGGTCGGAGGCCGGGGCCGGGGCCGGGGGACGGCGGCTCCCCGCGCGGCT
CCAGCGGCTCGGGGATCCCGGCCGGGCCCCGCAGGGACCATGGCAGCCGGGAGCATCACC
ACGCTGCCCGCCTTGCCCGAGGATGGCGGCAGCGGCGCCTTCCCGCCCGGCCACTTCAAG
GACCCCAAGCGGCTGTACTGCAAAAACGGGGGCTTCTTCCTGCGCATCCACCCCGACGGC
CGAGTTGACGGGGTCCGGGAGAAGAGCGACCCTCACATCAAGCTACAACTTCAAGCAGAA
GAGAGAGGAGTTGTGTCTATCAAAGGAGTGTGTGCTAACCGTTACCTGGCTATGAAGGAA
GATGGAAGATTACTGGCTTCTAAATGTGTTACGGATGAGTGTTTCTTTTTTGAACGATTG
GAATCTAATAACTACAATACTTACCGGTCAAGGAAATACACCAGTTGGTATGTGGCACTG
AAACGAACTGGGCAGTATAAACTTGGATCCAAAACAGGACCTGGGCAGAAAGCTATACTT
TTTCTTCCAATGTCTGCTAAGAGCTGA
GenBank Gene IDX04431
GeneCard IDNone
GenAtlas IDFGF2
HGNC IDHGNC:3676
Chromosome Location4
Locus4q26-q27
References
  1. Watson R, Anthony F, Pickett M, Lambden P, Masson GM, Thomas EJ: Reverse transcription with nested polymerase chain reaction shows expression of basic fibroblast growth factor transcripts in human granulosa and cumulus cells from in vitro fertilisation patients. Biochem Biophys Res Commun. 1992 Sep 30;187(3):1227-31.[1417798 ]
  2. Abraham JA, Whang JL, Tumolo A, Mergia A, Fiddes JC: Human basic fibroblast growth factor: nucleotide sequence, genomic organization, and expression in mammalian cells. Cold Spring Harb Symp Quant Biol. 1986;51 Pt 1:657-68.[3472745 ]
  3. Abraham JA, Whang JL, Tumolo A, Mergia A, Friedman J, Gospodarowicz D, Fiddes JC: Human basic fibroblast growth factor: nucleotide sequence and genomic organization. EMBO J. 1986 Oct;5(10):2523-8.[3780670 ]
  4. Prats H, Kaghad M, Prats AC, Klagsbrun M, Lelias JM, Liauzun P, Chalon P, Tauber JP, Amalric F, Smith JA, et al.: High molecular mass forms of basic fibroblast growth factor are initiated by alternative CUG codons. Proc Natl Acad Sci U S A. 1989 Mar;86(6):1836-40.[2538817 ]
  5. Goshima N, Kawamura Y, Fukumoto A, Miura A, Honma R, Satoh R, Wakamatsu A, Yamamoto J, Kimura K, Nishikawa T, Andoh T, Iida Y, Ishikawa K, Ito E, Kagawa N, Kaminaga C, Kanehori K, Kawakami B, Kenmochi K, Kimura R, Kobayashi M, Kuroita T, Kuwayama H, Maruyama Y, Matsuo K, Minami K, Mitsubori M, Mori M, Morishita R, Murase A, Nishikawa A, Nishikawa S, Okamoto T, Sakagami N, Sakamoto Y, Sasaki Y, Seki T, Sono S, Sugiyama A, Sumiya T, Takayama T, Takayama Y, Takeda H, Togashi T, Yahata K, Yamada H, Yanagisawa Y, Endo Y, Imamoto F, Kisu Y, Tanaka S, Isogai T, Imai J, Watanabe S, Nomura N: Human protein factory for converting the transcriptome into an in vitro-expressed proteome,. Nat Methods. 2008 Dec;5(12):1011-7.[19054851 ]
  6. Florkiewicz RZ, Shibata F, Barankiewicz T, Baird A, Gonzalez AM, Florkiewicz E, Shah N: Basic fibroblast growth factor gene expression. Ann N Y Acad Sci. 1991;638:109-26.[1785797 ]
  7. Kurokawa T, Sasada R, Iwane M, Igarashi K: Cloning and expression of cDNA encoding human basic fibroblast growth factor. FEBS Lett. 1987 Mar 9;213(1):189-94.[2435575 ]
  8. Shimoyama Y, Gotoh M, Ino Y, Sakamoto M, Kato K, Hirohashi S: Characterization of high-molecular-mass forms of basic fibroblast growth factor produced by hepatocellular carcinoma cells: possible involvement of basic fibroblast growth factor in hepatocarcinogenesis. Jpn J Cancer Res. 1991 Nov;82(11):1263-70.[1721615 ]
  9. Izbicka E, Dunstan C, Esparza J, Jacobs C, Sabatini M, Mundy GR: Human amniotic tumor that induces new bone formation in vivo produces growth-regulatory activity in vitro for osteoblasts identified as an extended form of basic fibroblast growth factor. Cancer Res. 1996 Feb 1;56(3):633-6.[8564983 ]
  10. Sommer A, Brewer MT, Thompson RC, Moscatelli D, Presta M, Rifkin DB: A form of human basic fibroblast growth factor with an extended amino terminus. Biochem Biophys Res Commun. 1987 Apr 29;144(2):543-50.[3579930 ]
  11. Story MT, Esch F, Shimasaki S, Sasse J, Jacobs SC, Lawson RK: Amino-terminal sequence of a large form of basic fibroblast growth factor isolated from human benign prostatic hyperplastic tissue. Biochem Biophys Res Commun. 1987 Feb 13;142(3):702-9.[2435284 ]
  12. Gimenez-Gallego G, Conn G, Hatcher VB, Thomas KA: Human brain-derived acidic and basic fibroblast growth factors: amino terminal sequences and specific mitogenic activities. Biochem Biophys Res Commun. 1986 Mar 13;135(2):541-8.[3964259 ]
  13. Gautschi P, Frater-Schroder M, Bohlen P: Partial molecular characterization of endothelial cell mitogens from human brain: acidic and basic fibroblast growth factors. FEBS Lett. 1986 Aug 18;204(2):203-7.[3732516 ]
  14. Ornitz DM, Xu J, Colvin JS, McEwen DG, MacArthur CA, Coulier F, Gao G, Goldfarb M: Receptor specificity of the fibroblast growth factor family. J Biol Chem. 1996 Jun 21;271(25):15292-7.[8663044 ]
  15. Tassi E, Al-Attar A, Aigner A, Swift MR, McDonnell K, Karavanov A, Wellstein A: Enhancement of fibroblast growth factor (FGF) activity by an FGF-binding protein. J Biol Chem. 2001 Oct 26;276(43):40247-53. Epub 2001 Aug 16.[11509569 ]
  16. Skjerpen CS, Wesche J, Olsnes S: Identification of ribosome-binding protein p34 as an intracellular protein that binds acidic fibroblast growth factor. J Biol Chem. 2002 Jun 28;277(26):23864-71. Epub 2002 Apr 18.[11964394 ]
  17. Xie B, Tassi E, Swift MR, McDonnell K, Bowden ET, Wang S, Ueda Y, Tomita Y, Riegel AT, Wellstein A: Identification of the fibroblast growth factor (FGF)-interacting domain in a secreted FGF-binding protein by phage display. J Biol Chem. 2006 Jan 13;281(2):1137-44. Epub 2005 Oct 27.[16257968 ]
  18. Zhang W, Chen Y, Swift MR, Tassi E, Stylianou DC, Gibby KA, Riegel AT, Wellstein A: Effect of FGF-binding protein 3 on vascular permeability. J Biol Chem. 2008 Oct 17;283(42):28329-37. doi: 10.1074/jbc.M802144200. Epub 2008 Jul 31.[18669637 ]
  19. Ebert AD, Laussmann M, Wegehingel S, Kaderali L, Erfle H, Reichert J, Lechner J, Beer HD, Pepperkok R, Nickel W: Tec-kinase-mediated phosphorylation of fibroblast growth factor 2 is essential for unconventional secretion. Traffic. 2010 Jun;11(6):813-26. doi: 10.1111/j.1600-0854.2010.01059.x. Epub 2010 Mar 10.[20230531 ]
  20. Eswarakumar VP, Lax I, Schlessinger J: Cellular signaling by fibroblast growth factor receptors. Cytokine Growth Factor Rev. 2005 Apr;16(2):139-49. Epub 2005 Feb 1.[15863030 ]
  21. Turner N, Grose R: Fibroblast growth factor signalling: from development to cancer. Nat Rev Cancer. 2010 Feb;10(2):116-29. doi: 10.1038/nrc2780.[20094046 ]
  22. Zhen Y, Sorensen V, Skjerpen CS, Haugsten EM, Jin Y, Walchli S, Olsnes S, Wiedlocha A: Nuclear import of exogenous FGF1 requires the ER-protein LRRC59 and the importins Kpnalpha1 and Kpnbeta1. Traffic. 2012 May;13(5):650-64. doi: 10.1111/j.1600-0854.2012.01341.x. Epub 2012 Mar 4.[22321063 ]
  23. Ago H, Kitagawa Y, Fujishima A, Matsuura Y, Katsube Y: Crystal structure of basic fibroblast growth factor at 1.6 A resolution. J Biochem. 1991 Sep;110(3):360-3.[1769963 ]
  24. Eriksson AE, Cousens LS, Weaver LH, Matthews BW: Three-dimensional structure of human basic fibroblast growth factor. Proc Natl Acad Sci U S A. 1991 Apr 15;88(8):3441-5.[1707542 ]
  25. Zhang JD, Cousens LS, Barr PJ, Sprang SR: Three-dimensional structure of human basic fibroblast growth factor, a structural homolog of interleukin 1 beta. Proc Natl Acad Sci U S A. 1991 Apr 15;88(8):3446-50.[1849658 ]
  26. Zhu X, Komiya H, Chirino A, Faham S, Fox GM, Arakawa T, Hsu BT, Rees DC: Three-dimensional structures of acidic and basic fibroblast growth factors. Science. 1991 Jan 4;251(4989):90-3.[1702556 ]
  27. Eriksson AE, Cousens LS, Matthews BW: Refinement of the structure of human basic fibroblast growth factor at 1.6 A resolution and analysis of presumed heparin binding sites by selenate substitution. Protein Sci. 1993 Aug;2(8):1274-84.[7691311 ]
  28. Ibrahimi OA, Eliseenkova AV, Plotnikov AN, Yu K, Ornitz DM, Mohammadi M: Structural basis for fibroblast growth factor receptor 2 activation in Apert syndrome. Proc Natl Acad Sci U S A. 2001 Jun 19;98(13):7182-7. Epub 2001 Jun 5.[11390973 ]
  29. Moy FJ, Seddon AP, Bohlen P, Powers R: High-resolution solution structure of basic fibroblast growth factor determined by multidimensional heteronuclear magnetic resonance spectroscopy. Biochemistry. 1996 Oct 22;35(42):13552-61.[8885834 ]
  30. Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M, Becker MC, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Kremitzki C, Oddy L, Du H, Sun H, Bradshaw-Cordum H, Ali J, Carter J, Cordes M, Harris A, Isak A, van Brunt A, Nguyen C, Du F, Courtney L, Kalicki J, Ozersky P, Abbott S, Armstrong J, Belter EA, Caruso L, Cedroni M, Cotton M, Davidson T, Desai A, Elliott G, Erb T, Fronick C, Gaige T, Haakenson W, Haglund K, Holmes A, Harkins R, Kim K, Kruchowski SS, Strong CM, Grewal N, Goyea E, Hou S, Levy A, Martinka S, Mead K, McLellan MD, Meyer R, Randall-Maher J, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Shah N, Swearengen-Shahid S, Snider J, Strong JT, Thompson J, Yoakum M, Leonard S, Pearman C, Trani L, Radionenko M, Waligorski JE, Wang C, Rock SM, Tin-Wollam AM, Maupin R, Latreille P, Wendl MC, Yang SP, Pohl C, Wallis JW, Spieth J, Bieri TA, Berkowicz N, Nelson JO, Osborne J, Ding L, Meyer R, Sabo A, Shotland Y, Sinha P, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Jones TA, She X, Ciccarelli FD, Izaurralde E, Taylor J, Schmutz J, Myers RM, Cox DR, Huang X, McPherson JD, Mardis ER, Clifton SW, Warren WC, Chinwalla AT, Eddy SR, Marra MA, Ovcharenko I, Furey TS, Miller W, Eichler EE, Bork P, Suyama M, Torrents D, Waterston RH, Wilson RK: Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Nature. 2005 Apr 7;434(7034):724-31.[15815621 ]
  31. Wu DQ, Kan MK, Sato GH, Okamoto T, Sato JD: Characterization and molecular cloning of a putative binding protein for heparin-binding growth factors. J Biol Chem. 1991 Sep 5;266(25):16778-85.[1885605 ]
  32. Goretzki L, Burg MA, Grako KA, Stallcup WB: High-affinity binding of basic fibroblast growth factor and platelet-derived growth factor-AA to the core protein of the NG2 proteoglycan. J Biol Chem. 1999 Jun 11;274(24):16831-7.[10358027 ]

Related FRC

FRCD ID Name Exact Mass Structure




F04718



Heparin


340.31