Histone H2A-Bbd type 2/3


NameHistone H2A-Bbd type 2/3
SynonymsH2A Barr body-deficient H2A.Bbd H2ABBD H2AFB
Gene NameH2AFB2
OrganismHuman
Amino acid sequence
>lcl|BSEQ0013500|Histone H2A-Bbd type 2/3
MPRRRRRRGSSGAGGRGRTCSRTVRAELSFSVSQVERSLREGHYAQRLSRTAPVYLAAVI
EYLTAKVLELAGNEAQNSGERNITPLLLDMVVHNDRLLSTLFNTTTISQVAPGED
Number of residues115
Molecular Weight12713.25
Theoretical pINone
GO Classification
Functions
    DNA binding
Processes
    mRNA processing
    chromatin silencing
    nucleosome assembly
Components
    nucleus
    nuclear nucleosome
    transcriptionally active chromatin
General FunctionDna binding
Specific FunctionAtypical histone H2A which can replace conventional H2A in some nucleosomes and is associated with active transcription and mRNA processing. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. Nucleosomes containing this histone are less rigid and organize less DNA than canonical nucleosomes in vivo. They are enriched in actively transcribed genes and associate with the elongating form of RNA polymerase. They associate with spliceosome components and are required for mRNA splicing. May participate in spermatogenesis.
Transmembrane Regions
GenBank Protein ID
UniProtKB IDP0C5Z0
UniProtKB Entry NameH2AB2_HUMAN
Cellular LocationNucleus
Gene sequence
>lcl|BSEQ0013501|Histone H2A-Bbd type 2/3 (H2AFB2)
ATGCCGAGGAGGAGGAGACGCCGAGGGTCCTCCGGTGCTGGCGGCCGGGGGCGGACCTGC
TCTCGCACCGTCCGAGCGGAGCTTTCGTTTTCAGTGAGCCAGGTGGAGCGCAGTCTACGG
GAGGGCCACTACGCTCAGCGCCTGAGTCGCACGGCGCCGGTCTACCTCGCTGCGGTTATT
GAGTACCTGACGGCCAAGGTCCTGGAGCTGGCGGGCAACGAGGCCCAGAACAGCGGAGAG
CGGAACATCACTCCCCTGCTGCTGGACATGGTGGTTCACAACGACAGGCTACTGAGCACC
CTTTTCAACACGACCACCATCTCTCAAGTGGCCCCTGGCGAGGACTAG
GenBank Gene ID
GeneCard IDNone
GenAtlas ID
HGNC IDHGNC:18298
Chromosome LocationX
LocusNone
References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7.[15489334 ]
  2. Chadwick BP, Willard HF: A novel chromatin protein, distantly related to histone H2A, is largely excluded from the inactive X chromosome. J Cell Biol. 2001 Jan 22;152(2):375-84.[11266453 ]
  3. Ross MT, Grafham DV, Coffey AJ, Scherer S, McLay K, Muzny D, Platzer M, Howell GR, Burrows C, Bird CP, Frankish A, Lovell FL, Howe KL, Ashurst JL, Fulton RS, Sudbrak R, Wen G, Jones MC, Hurles ME, Andrews TD, Scott CE, Searle S, Ramser J, Whittaker A, Deadman R, Carter NP, Hunt SE, Chen R, Cree A, Gunaratne P, Havlak P, Hodgson A, Metzker ML, Richards S, Scott G, Steffen D, Sodergren E, Wheeler DA, Worley KC, Ainscough R, Ambrose KD, Ansari-Lari MA, Aradhya S, Ashwell RI, Babbage AK, Bagguley CL, Ballabio A, Banerjee R, Barker GE, Barlow KF, Barrett IP, Bates KN, Beare DM, Beasley H, Beasley O, Beck A, Bethel G, Blechschmidt K, Brady N, Bray-Allen S, Bridgeman AM, Brown AJ, Brown MJ, Bonnin D, Bruford EA, Buhay C, Burch P, Burford D, Burgess J, Burrill W, Burton J, Bye JM, Carder C, Carrel L, Chako J, Chapman JC, Chavez D, Chen E, Chen G, Chen Y, Chen Z, Chinault C, Ciccodicola A, Clark SY, Clarke G, Clee CM, Clegg S, Clerc-Blankenburg K, Clifford K, Cobley V, Cole CG, Conquer JS, Corby N, Connor RE, David R, Davies J, Davis C, Davis J, Delgado O, Deshazo D, Dhami P, Ding Y, Dinh H, Dodsworth S, Draper H, Dugan-Rocha S, Dunham A, Dunn M, Durbin KJ, Dutta I, Eades T, Ellwood M, Emery-Cohen A, Errington H, Evans KL, Faulkner L, Francis F, Frankland J, Fraser AE, Galgoczy P, Gilbert J, Gill R, Glockner G, Gregory SG, Gribble S, Griffiths C, Grocock R, Gu Y, Gwilliam R, Hamilton C, Hart EA, Hawes A, Heath PD, Heitmann K, Hennig S, Hernandez J, Hinzmann B, Ho S, Hoffs M, Howden PJ, Huckle EJ, Hume J, Hunt PJ, Hunt AR, Isherwood J, Jacob L, Johnson D, Jones S, de Jong PJ, Joseph SS, Keenan S, Kelly S, Kershaw JK, Khan Z, Kioschis P, Klages S, Knights AJ, Kosiura A, Kovar-Smith C, Laird GK, Langford C, Lawlor S, Leversha M, Lewis L, Liu W, Lloyd C, Lloyd DM, Loulseged H, Loveland JE, Lovell JD, Lozado R, Lu J, Lyne R, Ma J, Maheshwari M, Matthews LH, McDowall J, McLaren S, McMurray A, Meidl P, Meitinger T, Milne S, Miner G, Mistry SL, Morgan M, Morris S, Muller I, Mullikin JC, Nguyen N, Nordsiek G, Nyakatura G, O'Dell CN, Okwuonu G, Palmer S, Pandian R, Parker D, Parrish J, Pasternak S, Patel D, Pearce AV, Pearson DM, Pelan SE, Perez L, Porter KM, Ramsey Y, Reichwald K, Rhodes S, Ridler KA, Schlessinger D, Schueler MG, Sehra HK, Shaw-Smith C, Shen H, Sheridan EM, Shownkeen R, Skuce CD, Smith ML, Sotheran EC, Steingruber HE, Steward CA, Storey R, Swann RM, Swarbreck D, Tabor PE, Taudien S, Taylor T, Teague B, Thomas K, Thorpe A, Timms K, Tracey A, Trevanion S, Tromans AC, d'Urso M, Verduzco D, Villasana D, Waldron L, Wall M, Wang Q, Warren J, Warry GL, Wei X, West A, Whitehead SL, Whiteley MN, Wilkinson JE, Willey DL, Williams G, Williams L, Williamson A, Williamson H, Wilming L, Woodmansey RL, Wray PW, Yen J, Zhang J, Zhou J, Zoghbi H, Zorilla S, Buck D, Reinhardt R, Poustka A, Rosenthal A, Lehrach H, Meindl A, Minx PJ, Hillier LW, Willard HF, Wilson RK, Waterston RH, Rice CM, Vaudin M, Coulson A, Nelson DL, Weinstock G, Sulston JE, Durbin R, Hubbard T, Gibbs RA, Beck S, Rogers J, Bentley DR: The DNA sequence of the human X chromosome. Nature. 2005 Mar 17;434(7031):325-37.[15772651 ]
  4. Bao Y, Konesky K, Park YJ, Rosu S, Dyer PN, Rangasamy D, Tremethick DJ, Laybourn PJ, Luger K: Nucleosomes containing the histone variant H2A.Bbd organize only 118 base pairs of DNA. EMBO J. 2004 Aug 18;23(16):3314-24. Epub 2004 Jul 15.[15257289 ]
  5. Okuwaki M, Kato K, Shimahara H, Tate S, Nagata K: Assembly and disassembly of nucleosome core particles containing histone variants by human nucleosome assembly protein I. Mol Cell Biol. 2005 Dec;25(23):10639-51.[16287874 ]
  6. Doyen CM, Montel F, Gautier T, Menoni H, Claudet C, Delacour-Larose M, Angelov D, Hamiche A, Bednar J, Faivre-Moskalenko C, Bouvet P, Dimitrov S: Dissection of the unusual structural and functional properties of the variant H2A.Bbd nucleosome. EMBO J. 2006 Sep 20;25(18):4234-44. Epub 2006 Sep 7.[16957777 ]
  7. Menoni H, Gasparutto D, Hamiche A, Cadet J, Dimitrov S, Bouvet P, Angelov D: ATP-dependent chromatin remodeling is required for base excision repair in conventional but not in variant H2A.Bbd nucleosomes. Mol Cell Biol. 2007 Sep;27(17):5949-56. Epub 2007 Jun 25.[17591702 ]
  8. Eirin-Lopez JM, Ishibashi T, Ausio J: H2A.Bbd: a quickly evolving hypervariable mammalian histone that destabilizes nucleosomes in an acetylation-independent way. FASEB J. 2008 Jan;22(1):316-26. Epub 2007 Aug 28.[17726088 ]
  9. Gonzalez-Romero R, Mendez J, Ausio J, Eirin-Lopez JM: Quickly evolving histones, nucleosome stability and chromatin folding: all about histone H2A.Bbd. Gene. 2008 Apr 30;413(1-2):1-7. doi: 10.1016/j.gene.2008.02.003. Epub 2008 Feb 16.[18329190 ]
  10. Ishibashi T, Li A, Eirin-Lopez JM, Zhao M, Missiaen K, Abbott DW, Meistrich M, Hendzel MJ, Ausio J: H2A.Bbd: an X-chromosome-encoded histone involved in mammalian spermiogenesis. Nucleic Acids Res. 2010 Apr;38(6):1780-9. doi: 10.1093/nar/gkp1129. Epub 2009 Dec 11.[20008104 ]
  11. Tolstorukov MY, Goldman JA, Gilbert C, Ogryzko V, Kingston RE, Park PJ: Histone variant H2A.Bbd is associated with active transcription and mRNA processing in human cells. Mol Cell. 2012 Aug 24;47(4):596-607. doi: 10.1016/j.molcel.2012.06.011. Epub 2012 Jul 12.[22795134 ]

Related FRC


FRCD ID Name Exact Mass Structure



Nickelocene




188.883



Benzene




78.114



Nickel




58.693



Nickel chloride




129.593