C-C motif chemokine 2
| Name | C-C motif chemokine 2 |
|---|---|
| Synonyms | HC11 MCAF MCP-1 MCP1 Monocyte chemoattractant protein 1 Monocyte chemotactic and activating factor Monocyte chemotactic protein 1 Monocyte secretory protein JE SCYA2 Small-inducible cytokine A2 |
| Gene Name | CCL2 |
| Organism | Human |
| Amino acid sequence | >lcl|BSEQ0010732|C-C motif chemokine 2 MKVSAALLCLLLIAATFIPQGLAQPDAINAPVTCCYNFTNRKISVQRLASYRRITSSKCP KEAVIFKTIVAKEICADPKQKWVQDSMDHLDKQTQTPKT |
| Number of residues | 99 |
| Molecular Weight | 11024.87 |
| Theoretical pI | 9.72 |
| GO Classification |
Functions
heparin binding receptor binding chemokine activity CCR2 chemokine receptor binding protein kinase activity Processes
negative regulation of glial cell apoptotic process chemotaxis cellular response to platelet-derived growth factor stimulus negative regulation of neuron apoptotic process response to bacterium cell adhesion cellular response to ATP cellular homeostasis negative regulation of natural killer cell chemotaxis positive regulation of calcium ion import organ morphogenesis cellular response to organic cyclic compound positive regulation of GTPase activity cellular response to high density lipoprotein particle stimulus positive regulation of apoptotic cell clearance cellular response to fibroblast growth factor stimulus positive regulation of ERK1 and ERK2 cascade response to gamma radiation G-protein coupled receptor signaling pathway response to antibiotic protein kinase B signaling cellular response to interferon-gamma positive regulation of cellular extravasation cellular response to retinoic acid response to mechanical stimulus JAK-STAT cascade positive regulation of synaptic transmission cell surface receptor signaling pathway angiogenesis cellular response to interleukin-6 monocyte chemotaxis positive regulation of immune complex clearance by monocytes and macrophages cellular response to tumor necrosis factor endoplasmic reticulum unfolded protein response maternal process involved in parturition positive regulation of collagen biosynthetic process viral genome replication cellular response to insulin stimulus eosinophil chemotaxis response to heat positive regulation of leukocyte mediated cytotoxicity cellular protein metabolic process PERK-mediated unfolded protein response cellular response to macrophage colony-stimulating factor stimulus response to wounding helper T cell extravasation positive regulation of macrophage chemotaxis MAPK cascade response to amino acid chemokine-mediated signaling pathway neutrophil chemotaxis cellular response to lipopolysaccharide aging leukocyte migration involved in inflammatory response positive regulation of nitric-oxide synthase biosynthetic process protein phosphorylation cellular response to drug positive regulation of tumor necrosis factor production cytoskeleton organization humoral immune response cytokine-mediated signaling pathway cellular response to dexamethasone stimulus lymphocyte chemotaxis organ regeneration positive regulation of T cell activation response to hypoxia positive regulation of monocyte chemotaxis response to activity cellular response to interleukin-1 inflammatory response cellular calcium ion homeostasis maternal process involved in female pregnancy macrophage chemotaxis response to progesterone regulation of vascular endothelial growth factor production vascular endothelial growth factor receptor signaling pathway transforming growth factor beta receptor signaling pathway G-protein coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger signal transduction regulation of cell shape lipopolysaccharide-mediated signaling pathway positive regulation of endothelial cell proliferation negative regulation of angiogenesis positive regulation of protein targeting to membrane response to vitamin B3 response to ethanol astrocyte cell migration Components
dendrite perinuclear region of cytoplasm synapse extracellular region endocytic vesicle rough endoplasmic reticulum extracellular space C-fiber axon terminus perikaryon |
| General Function | None |
| Specific Function | None |
| Transmembrane Regions | |
| GenBank Protein ID | 307163 |
| UniProtKB ID | P13500 |
| UniProtKB Entry Name | CCL2_HUMAN |
| Cellular Location | Secreted |
| Gene sequence | >lcl|BSEQ0010733|C-C motif chemokine 2 (CCL2) ATGAAAGTCTCTGCCGCCCTTCTGTGCCTGCTGCTCATAGCAGCCACCTTCATTCCCCAA GGGCTCGCTCAGCCAGATGCAATCAATGCCCCAGTCACCTGCTGTTATAACTTCACCAAT AGGAAGATCTCAGTGCAGAGGCTCGCGAGCTATAGAAGAATCACCAGCAGCAAGTGTCCC AAAGAAGCTGTGATCTTCAAGACCATTGTGGCCAAGGAGATCTGTGCTGACCCCAAGCAG AAGTGGGTTCAGGATTCCATGGACCACCTGGACAAGCAAACCCAAACTCCGAAGACTTGA |
| GenBank Gene ID | M24545 |
| GeneCard ID | None |
| GenAtlas ID | CCL2 |
| HGNC ID | HGNC:10618 |
| Chromosome Location | None |
| Locus | 17q11.2-q12 |
| References |
|