CCAAT/enhancer-binding protein beta

NameCCAAT/enhancer-binding protein beta
SynonymsC/EBP beta LAP LIP Liver activator protein Liver-enriched inhibitory protein Nuclear factor NF-IL6 TCF-5 TCF5 Transcription factor 5
Gene NameCEBPB
OrganismHuman
Amino acid sequence
>lcl|BSEQ0009209|CCAAT/enhancer-binding protein beta
MQRLVAWDPACLPLPPPPPAFKSMEVANFYYEADCLAAAYGGKAAPAAPPAARPGPRPPA
GELGSIGDHERAIDFSPYLEPLGAPQAPAPATATDTFEAAPPAPAPAPASSGQHHDFLSD
LFSDDYGGKNCKKPAEYGYVSLGRLGAAKGALHPGCFAPLHPPPPPPPPPAELKAEPGFE
PADCKRKEEAGAPGGGAGMAAGFPYALRAYLGYQAVPSGSSGSLSTSSSSSPPGTPSPAD
AKAPPTACYAGAAPAPSQVKSKAKKTVDKHSDEYKIRRERNNIAVRKSRDKAKMRNLETQ
HKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPEPLLASSGHC
Number of residues345
Molecular Weight36105.36
Theoretical pINone
GO Classification
Functions
    RNA polymerase II core promoter proximal region sequence-specific DNA binding
transcriptional activator activity, RNA polymerase II core promoter proximal region sequence-specific binding
DNA binding
transcription factor activity, RNA polymerase II distal enhancer sequence-specific binding
protein heterodimerization activity
transcription factor activity, sequence-specific DNA binding
chromatin binding
protein homodimerization activity
RNA polymerase II regulatory region sequence-specific DNA binding
Processes
    positive regulation of transcription from RNA polymerase II promoter in response to endoplasmic reticulum stress
positive regulation of osteoblast differentiation
ovarian follicle development
regulation of transcription, DNA-templated
positive regulation of interleukin-4 production
cellular response to amino acid stimulus
granuloma formation
negative regulation of neuron apoptotic process
positive regulation of transcription from RNA polymerase II promoter
hepatocyte proliferation
response to endoplasmic reticulum stress
embryonic placenta development
acute-phase response
regulation of interleukin-6 biosynthetic process
intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress
mammary gland epithelial cell proliferation
defense response to bacterium
regulation of transcription involved in cell fate commitment
immune response
T-helper 1 cell activation
regulation of osteoclast differentiation
response to lipopolysaccharide
mammary gland epithelial cell differentiation
inflammatory response
liver regeneration
positive regulation of fat cell differentiation
negative regulation of transcription, DNA-templated
transcription from RNA polymerase II promoter
brown fat cell differentiation
neuron differentiation
negative regulation of T cell proliferation
Components
    nucleoplasm
CHOP-C/EBP complex
cytoplasm
nucleus
nuclear chromatin
condensed chromosome, centromeric region
nuclear matrix
General FunctionTranscriptional activator activity, rna polymerase ii core promoter proximal region sequence-specific binding
Specific FunctionImportant transcription factor regulating the expression of genes involved in immune and inflammatory responses (PubMed:9374525, PubMed:12048245, PubMed:18647749). Plays also a significant role in adipogenesis, as well as in the gluconeogenic pathway, liver regeneration, and hematopoiesis. The consensus recognition site is 5'-T[TG]NNGNAA[TG]-3'. Its functional capacity is governed by protein interactions and post-translational protein modifications. During early embryogenesis, plays essential and redundant functions with CEBPA. Has a promitotic effect on many cell types such as hepatocytes and adipocytes but has an antiproliferative effect on T-cells by repressing MYC expression, facilitating differentiation along the T-helper 2 lineage. Binds to regulatory regions of several acute-phase and cytokines genes and plays a role in the regulation of acute-phase reaction and inflammation. Plays also a role in intracellular bacteria killing (By similarity). During adipogenesis, is rapidly expressed and, after activation by phosphorylation, induces CEBPA and PPARG, which turn on the series of adipocyte genes that give rise to the adipocyte phenotype. The delayed transactivation of the CEBPA and PPARG genes by CEBPB appears necessary to allow mitotic clonal expansion and thereby progression of terminal differentiation (PubMed:20829347). Essential for female reproduction because of a critical role in ovarian follicle development (By similarity). Restricts osteoclastogenesis (By similarity).Isoform 2: Essential for gene expression induction in activated macrophages. Plays a major role in immune responses such as CD4(+) T-cell response, granuloma formation and endotoxin shock. Not essential for intracellular bacteria killing.Isoform 3: Acts as a dominant negative through heterodimerization with isoform 2 (PubMed:11741938). Promotes osteoblast differentiation and osteoclastogenesis (By similarity).
Transmembrane Regions
GenBank Protein ID
UniProtKB IDP17676
UniProtKB Entry NameCEBPB_HUMAN
Cellular LocationNucleus
Gene sequence
>lcl|BSEQ0013674|CCAAT/enhancer-binding protein beta (CEBPB)
ATGGAAGTGGCCAACTTCTACTACGAGGCGGACTGCTTGGCTGCTGCGTACGGCGGCAAG
GCGGCCCCCGCGGCGCCCCCCGCGGCCAGACCCGGGCCGCGCCCCCCCGCCGGCGAGCTG
GGCAGCATCGGCGACCACGAGCGCGCCATCGACTTCAGCCCGTACCTGGAGCCGCTGGGC
GCGCCGCAGGCCCCGGCGCCCGCCACGGCCACGGACACCTTCGAGGCGGCTCCGCCCGCG
CCCGCCCCCGCGCCCGCCTCCTCCGGGCAGCACCACGACTTCCTCTCCGACCTCTTCTCC
GACGACTACGGGGGCAAGAACTGCAAGAAGCCGGCCGAGTACGGCTACGTGAGCCTGGGG
CGCCTGGGGGCCGCCAAGGGCGCGCTGCACCCCGGCTGCTTCGCGCCCCTGCACCCACCG
CCCCCGCCGCCGCCGCCGCCCGCCGAGCTCAAGGCGGAGCCGGGCTTCGAGCCCGCGGAC
TGCAAGCGGAAGGAGGAGGCCGGGGCGCCGGGCGGCGGCGCAGGCATGGCGGCGGGCTTC
CCGTACGCGCTGCGCGCTTACCTCGGCTACCAGGCGGTGCCGAGCGGCAGCAGCGGGAGC
CTCTCCACGTCCTCCTCGTCCAGCCCGCCCGGCACGCCGAGCCCCGCTGACGCCAAGGCG
CCCCCGACCGCCTGCTACGCGGGGGCCGCGCCGGCGCCCTCGCAGGTCAAGAGCAAGGCC
AAGAAGACCGTGGACAAGCACAGCGACGAGTACAAGATCCGGCGCGAGCGCAACAACATC
GCCGTGCGCAAGAGCCGCGACAAGGCCAAGATGCGCAACCTGGAGACGCAGCACAAGGTC
CTGGAGCTCACGGCCGAGAACGAGCGGCTGCAGAAGAAGGTGGAGCAGCTGTCGCGCGAG
CTCAGCACCCTGCGGAACTTGTTCAAGCAGCTGCCCGAGCCCCTGCTCGCCTCCTCCGGC
CACTGCTAG
GenBank Gene ID
GeneCard IDNone
GenAtlas ID
HGNC IDHGNC:1834
Chromosome Location20
LocusNone
References
  1. Akira S, Isshiki H, Sugita T, Tanabe O, Kinoshita S, Nishio Y, Nakajima T, Hirano T, Kishimoto T: A nuclear factor for IL-6 expression (NF-IL6) is a member of a C/EBP family. EMBO J. 1990 Jun;9(6):1897-906.[2112087 ]
  2. Wan D, Gong Y, Qin W, Zhang P, Li J, Wei L, Zhou X, Li H, Qiu X, Zhong F, He L, Yu J, Yao G, Jiang H, Qian L, Yu Y, Shu H, Chen X, Xu H, Guo M, Pan Z, Chen Y, Ge C, Yang S, Gu J: Large-scale cDNA transfection screening for genes related to cancer development and progression. Proc Natl Acad Sci U S A. 2004 Nov 2;101(44):15724-9. Epub 2004 Oct 21.[15498874 ]
  3. Deloukas P, Matthews LH, Ashurst J, Burton J, Gilbert JG, Jones M, Stavrides G, Almeida JP, Babbage AK, Bagguley CL, Bailey J, Barlow KF, Bates KN, Beard LM, Beare DM, Beasley OP, Bird CP, Blakey SE, Bridgeman AM, Brown AJ, Buck D, Burrill W, Butler AP, Carder C, Carter NP, Chapman JC, Clamp M, Clark G, Clark LN, Clark SY, Clee CM, Clegg S, Cobley VE, Collier RE, Connor R, Corby NR, Coulson A, Coville GJ, Deadman R, Dhami P, Dunn M, Ellington AG, Frankland JA, Fraser A, French L, Garner P, Grafham DV, Griffiths C, Griffiths MN, Gwilliam R, Hall RE, Hammond S, Harley JL, Heath PD, Ho S, Holden JL, Howden PJ, Huckle E, Hunt AR, Hunt SE, Jekosch K, Johnson CM, Johnson D, Kay MP, Kimberley AM, King A, Knights A, Laird GK, Lawlor S, Lehvaslaiho MH, Leversha M, Lloyd C, Lloyd DM, Lovell JD, Marsh VL, Martin SL, McConnachie LJ, McLay K, McMurray AA, Milne S, Mistry D, Moore MJ, Mullikin JC, Nickerson T, Oliver K, Parker A, Patel R, Pearce TA, Peck AI, Phillimore BJ, Prathalingam SR, Plumb RW, Ramsay H, Rice CM, Ross MT, Scott CE, Sehra HK, Shownkeen R, Sims S, Skuce CD, Smith ML, Soderlund C, Steward CA, Sulston JE, Swann M, Sycamore N, Taylor R, Tee L, Thomas DW, Thorpe A, Tracey A, Tromans AC, Vaudin M, Wall M, Wallis JM, Whitehead SL, Whittaker P, Willey DL, Williams L, Williams SA, Wilming L, Wray PW, Hubbard T, Durbin RM, Bentley DR, Beck S, Rogers J: The DNA sequence and comparative analysis of human chromosome 20. Nature. 2001 Dec 20-27;414(6866):865-71.[11780052 ]
  4. Toda K, Akira S, Kishimoto T, Sasaki H, Hashimoto K, Yamamoto Y, Sagara Y, Shizuta Y: Identification of a transcriptional regulatory factor for human aromatase cytochrome P450 gene expression as nuclear factor interleukin-6 (NF-IL6), a member of the CCAAT/enhancer-binding protein family. Eur J Biochem. 1995 Jul 15;231(2):292-9.[7635140 ]
  5. Chinery R, Brockman JA, Dransfield DT, Coffey RJ: Antioxidant-induced nuclear translocation of CCAAT/enhancer-binding protein beta. A critical role for protein kinase A-mediated phosphorylation of Ser299. J Biol Chem. 1997 Nov 28;272(48):30356-61.[9374525 ]
  6. Buck M, Poli V, Hunter T, Chojkier M: C/EBPbeta phosphorylation by RSK creates a functional XEXD caspase inhibitory box critical for cell survival. Mol Cell. 2001 Oct;8(4):807-16.[11684016 ]
  7. Zhu Y, Saunders MA, Yeh H, Deng WG, Wu KK: Dynamic regulation of cyclooxygenase-2 promoter activity by isoforms of CCAAT/enhancer-binding proteins. J Biol Chem. 2002 Mar 1;277(9):6923-8. Epub 2001 Dec 10.[11741938 ]
  8. Roy SK, Hu J, Meng Q, Xia Y, Shapiro PS, Reddy SP, Platanias LC, Lindner DJ, Johnson PF, Pritchard C, Pages G, Pouyssegur J, Kalvakolanu DV: MEKK1 plays a critical role in activating the transcription factor C/EBP-beta-dependent gene expression in response to IFN-gamma. Proc Natl Acad Sci U S A. 2002 Jun 11;99(12):7945-50. Epub 2002 Jun 4.[12048245 ]
  9. Eaton EM, Sealy L: Modification of CCAAT/enhancer-binding protein-beta by the small ubiquitin-like modifier (SUMO) family members, SUMO-2 and SUMO-3. J Biol Chem. 2003 Aug 29;278(35):33416-21. Epub 2003 Jun 16.[12810706 ]
  10. Piskacek S, Gregor M, Nemethova M, Grabner M, Kovarik P, Piskacek M: Nine-amino-acid transactivation domain: establishment and prediction utilities. Genomics. 2007 Jun;89(6):756-68. Epub 2007 Apr 30.[17467953 ]
  11. Pless O, Kowenz-Leutz E, Knoblich M, Lausen J, Beyermann M, Walsh MJ, Leutz A: G9a-mediated lysine methylation alters the function of CCAAT/enhancer-binding protein-beta. J Biol Chem. 2008 Sep 26;283(39):26357-63. doi: 10.1074/jbc.M802132200. Epub 2008 Jul 21.[18647749 ]
  12. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309.[19413330 ]
  13. Kowenz-Leutz E, Pless O, Dittmar G, Knoblich M, Leutz A: Crosstalk between C/EBPbeta phosphorylation, arginine methylation, and SWI/SNF/Mediator implies an indexing transcription factor code. EMBO J. 2010 Mar 17;29(6):1105-15. doi: 10.1038/emboj.2010.3. Epub 2010 Jan 28.[20111005 ]
  14. Park SH, Choi HJ, Yang H, Do KH, Kim J, Lee DW, Moon Y: Endoplasmic reticulum stress-activated C/EBP homologous protein enhances nuclear factor-kappaB signals via repression of peroxisome proliferator-activated receptor gamma. J Biol Chem. 2010 Nov 12;285(46):35330-9. doi: 10.1074/jbc.M110.136259. Epub 2010 Sep 9.[20829347 ]
  15. Hendriks IA, D'Souza RC, Yang B, Verlaan-de Vries M, Mann M, Vertegaal AC: Uncovering global SUMOylation signaling networks in a site-specific manner. Nat Struct Mol Biol. 2014 Oct;21(10):927-36. doi: 10.1038/nsmb.2890. Epub 2014 Sep 14.[25218447 ]
  16. Guo L, Li X, Tang QQ: Transcriptional regulation of adipocyte differentiation: a central role for CCAAT/enhancer-binding protein (C/EBP) beta. J Biol Chem. 2015 Jan 9;290(2):755-61. doi: 10.1074/jbc.R114.619957. Epub 2014 Dec 1.[25451943 ]
  17. Tahirov TH, Inoue-Bungo T, Morii H, Fujikawa A, Sasaki M, Kimura K, Shiina M, Sato K, Kumasaka T, Yamamoto M, Ishii S, Ogata K: Structural analyses of DNA recognition by the AML1/Runx-1 Runt domain and its allosteric control by CBFbeta. Cell. 2001 Mar 9;104(5):755-67.[11257229 ]
  18. Tahirov TH, Sato K, Ichikawa-Iwata E, Sasaki M, Inoue-Bungo T, Shiina M, Kimura K, Takata S, Fujikawa A, Morii H, Kumasaka T, Yamamoto M, Ishii S, Ogata K: Mechanism of c-Myb-C/EBP beta cooperation from separated sites on a promoter. Cell. 2002 Jan 11;108(1):57-70.[11792321 ]
  19. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21.[14702039 ]
  20. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7.[15489334 ]

Related FRC

FRCD ID Name Exact Mass Structure




F05401



Cyazofamid


324.783