DNA repair protein complementing XP-A cells


NameDNA repair protein complementing XP-A cells
SynonymsXeroderma pigmentosum group A-complementing protein XPAC
Gene NameXPA
OrganismHuman
Amino acid sequence
>lcl|BSEQ0013433|DNA repair protein complementing XP-A cells
MAAADGALPEAAALEQPAELPASVRASIERKRQRALMLRQARLAARPYSATAAAATGGMA
NVKAAPKIIDTGGGFILEEEEEEEQKIGKVVHQPGPVMEFDYVICEECGKEFMDSYLMNH
FDLPTCDNCRDADDKHKLITKTEAKQEYLLKDCDLEKREPPLKFIVKKNPHHSQWGDMKL
YLKLQIVKRSLEVWGSQEALEEAKEVRQENREKMKQKKFDKKVKELRRAVRSSVWKRETI
VHQHEYGPEENLEDDMYRKTCTMCGHELTYEKM
Number of residues273
Molecular Weight31367.71
Theoretical pINone
GO Classification
Functions
    damaged DNA binding
    protein homodimerization activity
    protein domain specific binding
    metal ion binding
Processes
    nucleotide-excision repair, DNA incision
    response to auditory stimulus
    intrinsic apoptotic signaling pathway in response to DNA damage
    multicellular organism growth
    DNA repair
    response to toxic substance
    response to oxidative stress
    global genome nucleotide-excision repair
    transcription-coupled nucleotide-excision repair
    response to UV
    nucleotide-excision repair
Components
    Golgi apparatus
    nucleoplasm
    cytoplasm
    nucleus
    intercellular bridge
General FunctionProtein homodimerization activity
Specific FunctionInvolved in DNA excision repair. Initiates repair by binding to damaged sites with various affinities, depending on the photoproduct and the transcriptional state of the region. Required for UV-induced CHEK1 phosphorylation and the recruitment of CEP164 to cyclobutane pyrimidine dimmers (CPD), sites of DNA damage after UV irradiation.
Transmembrane Regions
GenBank Protein ID
UniProtKB IDP23025
UniProtKB Entry NameXPA_HUMAN
Cellular LocationNucleus
Gene sequence
>lcl|BSEQ0013434|DNA repair protein complementing XP-A cells (XPA)
ATGGCGGCGGCCGACGGGGCTTTGCCGGAGGCGGCGGCTTTAGAGCAACCCGCGGAGCTG
CCTGCCTCGGTGCGGGCGAGTATCGAGCGGAAGCGGCAGCGGGCACTGATGCTGCGCCAG
GCCCGGCTGGCTGCCCGGCCCTACTCGGCGACGGCGGCTGCGGCTACTGGAGGCATGGCT
AATGTAAAAGCAGCCCCAAAGATAATTGACACAGGAGGAGGCTTCATTTTAGAAGAGGAA
GAAGAAGAAGAACAGAAAATTGGAAAAGTTGTTCATCAACCAGGACCTGTTATGGAATTT
GATTATGTAATATGCGAAGAATGTGGGAAAGAATTTATGGATTCTTATCTTATGAACCAC
TTTGATTTGCCAACTTGTGATAACTGCAGAGATGCTGATGATAAACACAAGCTTATAACC
AAAACAGAGGCAAAACAAGAATATCTTCTGAAAGACTGTGATTTAGAAAAAAGAGAGCCA
CCTCTTAAATTTATTGTGAAGAAGAATCCACATCATTCACAATGGGGTGATATGAAACTC
TACTTAAAGTTACAGATTGTGAAGAGGTCTCTTGAAGTTTGGGGTAGTCAAGAAGCATTA
GAAGAAGCAAAGGAAGTCCGACAGGAAAACCGAGAAAAAATGAAACAGAAGAAATTTGAT
AAAAAAGTAAAAGAATTGCGGCGAGCAGTAAGAAGCAGCGTGTGGAAAAGGGAGACGATT
GTTCATCAACATGAGTATGGACCAGAAGAAAACCTAGAAGATGACATGTACCGTAAGACT
TGTACTATGTGTGGCCATGAACTGACATATGAAAAAATGTGA
GenBank Gene ID
GeneCard IDNone
GenAtlas ID
HGNC IDHGNC:12814
Chromosome Location9
LocusNone
References
  1. Ikegami T, Kuraoka I, Saijo M, Kodo N, Kyogoku Y, Morikawa K, Tanaka K, Shirakawa M: Solution structure of the DNA- and RPA-binding domain of the human repair factor XPA. Nat Struct Biol. 1998 Aug;5(8):701-6.[9699634 ]
  2. Buchko GW, Daughdrill GW, de Lorimier R, Rao B K, Isern NG, Lingbeck JM, Taylor JS, Wold MS, Gochin M, Spicer LD, Lowry DF, Kennedy MA: Interactions of human nucleotide excision repair protein XPA with DNA and RPA70 Delta C327: chemical shift mapping and 15N NMR relaxation studies. Biochemistry. 1999 Nov 16;38(46):15116-28.[10563794 ]
  3. Satokata I, Tanaka K, Okada Y: Molecular basis of group A xeroderma pigmentosum: a missense mutation and two deletions located in a zinc finger consensus sequence of the XPAC gene. Hum Genet. 1992 Mar;88(6):603-7.[1339397 ]
  4. Tanaka K, Miura N, Satokata I, Miyamoto I, Yoshida MC, Satoh Y, Kondo S, Yasui A, Okayama H, Okada Y: Analysis of a human DNA excision repair gene involved in group A xeroderma pigmentosum and containing a zinc-finger domain. Nature. 1990 Nov 1;348(6296):73-6.[2234061 ]
  5. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7.[15489334 ]
  6. Satokata I, Iwai K, Matsuda T, Okada Y, Tanaka K: Genomic characterization of the human DNA excision repair-controlling gene XPAC. Gene. 1993 Dec 22;136(1-2):345-8.[8294029 ]
  7. He Z, Henricksen LA, Wold MS, Ingles CJ: RPA involvement in the damage-recognition and incision steps of nucleotide excision repair. Nature. 1995 Apr 6;374(6522):566-9.[7700386 ]
  8. Topping RS, Myrand SP, Williams BL, Albert JC, States JC: Characterization of the human XPA promoter. Gene. 1995 Dec 12;166(2):341-2.[8543191 ]
  9. Miura N, Miyamoto I, Asahina H, Satokata I, Tanaka K, Okada Y: Identification and characterization of xpac protein, the gene product of the human XPAC (xeroderma pigmentosum group A complementing) gene. J Biol Chem. 1991 Oct 15;266(29):19786-9.[1918083 ]
  10. Miyamoto I, Miura N, Niwa H, Miyazaki J, Tanaka K: Mutational analysis of the structure and function of the xeroderma pigmentosum group A complementing protein. Identification of essential domains for nuclear localization and DNA excision repair. J Biol Chem. 1992 Jun 15;267(17):12182-7.[1601884 ]
  11. Tanaka K: The Japan Society of Human Genetics Award Lecture. Molecular analysis of xeroderma pigmentosum group A gene. Jpn J Hum Genet. 1993 Mar;38(1):1-14.[8504220 ]
  12. Cleaver JE, Thompson LH, Richardson AS, States JC: A summary of mutations in the UV-sensitive disorders: xeroderma pigmentosum, Cockayne syndrome, and trichothiodystrophy. Hum Mutat. 1999;14(1):9-22.[10447254 ]
  13. Wu X, Shell SM, Yang Z, Zou Y: Phosphorylation of nucleotide excision repair factor xeroderma pigmentosum group A by ataxia telangiectasia mutated and Rad3-related-dependent checkpoint pathway promotes cell survival in response to UV irradiation. Cancer Res. 2006 Mar 15;66(6):2997-3005.[16540648 ]
  14. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309.[19413330 ]
  15. Pan YR, Lee EY: UV-dependent interaction between Cep164 and XPA mediates localization of Cep164 at sites of DNA damage and UV sensitivity. Cell Cycle. 2009 Feb 15;8(4):655-64. Epub 2009 Feb 14.[19197159 ]
  16. Kang TH, Lindsey-Boltz LA, Reardon JT, Sancar A: Circadian control of XPA and excision repair of cisplatin-DNA damage by cryptochrome and HERC2 ubiquitin ligase. Proc Natl Acad Sci U S A. 2010 Mar 16;107(11):4890-5. doi: 10.1073/pnas.0915085107.[20304803 ]
  17. Van Damme P, Lasa M, Polevoda B, Gazquez C, Elosegui-Artola A, Kim DS, De Juan-Pardo E, Demeyer K, Hole K, Larrea E, Timmerman E, Prieto J, Arnesen T, Sherman F, Gevaert K, Aldabe R: N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB. Proc Natl Acad Sci U S A. 2012 Jul 31;109(31):12449-54. doi: 10.1073/pnas.1210303109. Epub 2012 Jul 18.[22814378 ]
  18. Hendriks IA, D'Souza RC, Yang B, Verlaan-de Vries M, Mann M, Vertegaal AC: Uncovering global SUMOylation signaling networks in a site-specific manner. Nat Struct Mol Biol. 2014 Oct;21(10):927-36. doi: 10.1038/nsmb.2890. Epub 2014 Sep 14.[25218447 ]
  19. States JC, McDuffie ER, Myrand SP, McDowell M, Cleaver JE: Distribution of mutations in the human xeroderma pigmentosum group A gene and their relationships to the functional regions of the DNA damage recognition protein. Hum Mutat. 1998;12(2):103-13.[9671271 ]
  20. Humphray SJ, Oliver K, Hunt AR, Plumb RW, Loveland JE, Howe KL, Andrews TD, Searle S, Hunt SE, Scott CE, Jones MC, Ainscough R, Almeida JP, Ambrose KD, Ashwell RI, Babbage AK, Babbage S, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beasley H, Beasley O, Bird CP, Bray-Allen S, Brown AJ, Brown JY, Burford D, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Chen Y, Clarke G, Clark SY, Clee CM, Clegg S, Collier RE, Corby N, Crosier M, Cummings AT, Davies J, Dhami P, Dunn M, Dutta I, Dyer LW, Earthrowl ME, Faulkner L, Fleming CJ, Frankish A, Frankland JA, French L, Fricker DG, Garner P, Garnett J, Ghori J, Gilbert JG, Glison C, Grafham DV, Gribble S, Griffiths C, Griffiths-Jones S, Grocock R, Guy J, Hall RE, Hammond S, Harley JL, Harrison ES, Hart EA, Heath PD, Henderson CD, Hopkins BL, Howard PJ, Howden PJ, Huckle E, Johnson C, Johnson D, Joy AA, Kay M, Keenan S, Kershaw JK, Kimberley AM, King A, Knights A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd C, Lloyd DM, Lovell J, Martin S, Mashreghi-Mohammadi M, Matthews L, McLaren S, McLay KE, McMurray A, Milne S, Nickerson T, Nisbett J, Nordsiek G, Pearce AV, Peck AI, Porter KM, Pandian R, Pelan S, Phillimore B, Povey S, Ramsey Y, Rand V, Scharfe M, Sehra HK, Shownkeen R, Sims SK, Skuce CD, Smith M, Steward CA, Swarbreck D, Sycamore N, Tester J, Thorpe A, Tracey A, Tromans A, Thomas DW, Wall M, Wallis JM, West AP, Whitehead SL, Willey DL, Williams SA, Wilming L, Wray PW, Young L, Ashurst JL, Coulson A, Blocker H, Durbin R, Sulston JE, Hubbard T, Jackson MJ, Bentley DR, Beck S, Rogers J, Dunham I: DNA sequence and analysis of human chromosome 9. Nature. 2004 May 27;429(6990):369-74.[15164053 ]
  21. Satokata I, Tanaka K, Yuba S, Okada Y: Identification of splicing mutations of the last nucleotides of exons, a nonsense mutation, and a missense mutation of the XPAC gene as causes of group A xeroderma pigmentosum. Mutat Res. 1992 Mar;273(2):203-12.[1372103 ]

Related FRC


FRCD ID Name Exact Mass Structure



Cyanocobalamin




1356.396



Hydroxocobalamin




1346.377



Salcomine




327.249



Insulin




5793.602



Arsenic




74.922



Cadmium




112.414



Dimethylarsinate




136.99



Arsenate




141.942



Arsenobetaine




178.063



Arsenocholine




165.088



Nitarsone




247.038



Methylcobalamin




1344.405



Cobaltocene




189.123



Adenosylcobalamin




1579.608



Zinc




65.38



Roxarsone




263.037