Mitogen-activated protein kinase 3
| Name | Mitogen-activated protein kinase 3 |
|---|---|
| Synonyms | 2.7.11.24 ERK-1 ERK1 ERT2 Extracellular signal-regulated kinase 1 Insulin-stimulated MAP2 kinase MAP kinase 3 MAP kinase isoform p44 Microtubule-associated protein 2 kinase p44-ERK1 p44-MAPK PRKM3 |
| Gene Name | MAPK3 |
| Organism | Human |
| Amino acid sequence | >lcl|BSEQ0002115|Mitogen-activated protein kinase 3 MAAAAAQGGGGGEPRRTEGVGPGVPGEVEMVKGQPFDVGPRYTQLQYIGEGAYGMVSSAY DHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRASTLEAMRDVYI VQDLMETDLYKLLKSQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDL KICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLS NRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKSD SKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFAMELDDLPKERL KELIFQETARFQPGVLEAP |
| Number of residues | 379 |
| Molecular Weight | 43135.16 |
| Theoretical pI | 6.74 |
| GO Classification |
Functions
MAP kinase activity phosphatase binding ATP binding Processes
toll-like receptor 2 signaling pathway activation of MAPKK activity positive regulation of histone phosphorylation regulation of stress-activated MAPK cascade positive regulation of telomere maintenance via telomerase axon guidance JAK-STAT cascade involved in growth hormone signaling pathway toll-like receptor 3 signaling pathway apoptotic process interleukin-1-mediated signaling pathway small GTPase mediated signal transduction response to toxic substance ERK1 and ERK2 cascade regulation of cellular response to heat DNA damage induced protein phosphorylation toll-like receptor 4 signaling pathway fibroblast growth factor receptor signaling pathway transcription from RNA polymerase I promoter cell cycle cytokine-mediated signaling pathway regulation of cytoskeleton organization epidermal growth factor receptor signaling pathway toll-like receptor 5 signaling pathway insulin receptor signaling pathway caveolin-mediated endocytosis transcription initiation from RNA polymerase I promoter phosphorylation regulation of early endosome to late endosome transport Fc-gamma receptor signaling pathway involved in phagocytosis viral process toll-like receptor 9 signaling pathway MAPK cascade cellular response to heat positive regulation of cyclase activity platelet activation lipopolysaccharide-mediated signaling pathway regulation of Golgi inheritance innate immune response cartilage development neurotrophin TRK receptor signaling pathway toll-like receptor signaling pathway lung morphogenesis negative regulation of apolipoprotein binding protein complex assembly regulation of sequence-specific DNA binding transcription factor activity peptidyl-tyrosine autophosphorylation positive regulation of transcription from RNA polymerase II promoter toll-like receptor TLR1 MAPK import into nucleus positive regulation of ERK1 and ERK2 cascade response to epidermal growth factor positive regulation of protein phosphorylation protein phosphorylation toll-like receptor TLR6 MyD88-dependent toll-like receptor signaling pathway gene expression activation of MAPK activity response to exogenous dsRNA Fc-epsilon receptor signaling pathway Ras protein signal transduction trachea formation MyD88-independent toll-like receptor signaling pathway arachidonic acid metabolic process stress-activated MAPK cascade cellular response to mechanical stimulus blood coagulation vascular endothelial growth factor receptor signaling pathway TRIF-dependent toll-like receptor signaling pathway positive regulation of telomerase activity BMP signaling pathway toll-like receptor 10 signaling pathway positive regulation of histone acetylation sensory perception of pain positive regulation of translation positive regulation of telomere capping peptidyl-serine phosphorylation Components
caveola late endosome early endosome nuclear envelope mitochondrion protein complex focal adhesion Golgi apparatus cytoskeleton microtubule cytoskeleton cytosol extracellular exosome pseudopodium nucleus nucleoplasm |
| General Function | Phosphatase binding |
| Specific Function | Serine/threonine kinase which acts as an essential component of the MAP kinase signal transduction pathway. MAPK1/ERK2 and MAPK3/ERK1 are the 2 MAPKs which play an important role in the MAPK/ERK cascade. They participate also in a signaling cascade initiated by activated KIT and KITLG/SCF. Depending on the cellular context, the MAPK/ERK cascade mediates diverse biological functions such as cell growth, adhesion, survival and differentiation through the regulation of transcription, translation, cytoskeletal rearrangements. The MAPK/ERK cascade plays also a role in initiation and regulation of meiosis, mitosis, and postmitotic functions in differentiated cells by phosphorylating a number of transcription factors. About 160 substrates have already been discovered for ERKs. Many of these substrates are localized in the nucleus, and seem to participate in the regulation of transcription upon stimulation. However, other substrates are found in the cytosol as well as in other cellular organelles, and those are responsible for processes such as translation, mitosis and apoptosis. Moreover, the MAPK/ERK cascade is also involved in the regulation of the endosomal dynamics, including lysosome processing and endosome cycling through the perinuclear recycling compartment (PNRC); as well as in the fragmentation of the Golgi apparatus during mitosis. The substrates include transcription factors (such as ATF2, BCL6, ELK1, ERF, FOS, HSF4 or SPZ1), cytoskeletal elements (such as CANX, CTTN, GJA1, MAP2, MAPT, PXN, SORBS3 or STMN1), regulators of apoptosis (such as BAD, BTG2, CASP9, DAPK1, IER3, MCL1 or PPARG), regulators of translation (such as EIF4EBP1) and a variety of other signaling-related molecules (like ARHGEF2, FRS2 or GRB10). Protein kinases (such as RAF1, RPS6KA1/RSK1, RPS6KA3/RSK2, RPS6KA2/RSK3, RPS6KA6/RSK4, SYK, MKNK1/MNK1, MKNK2/MNK2, RPS6KA5/MSK1, RPS6KA4/MSK2, MAPKAPK3 or MAPKAPK5) and phosphatases (such as DUSP1, DUSP4, DUSP6 or DUSP16) are other substrates which enable the propagation the MAPK/ERK signal to additional cytosolic and nuclear targets, thereby extending the specificity of the cascade. |
| Transmembrane Regions | |
| GenBank Protein ID | 31221 |
| UniProtKB ID | P27361 |
| UniProtKB Entry Name | MK03_HUMAN |
| Cellular Location | Cytoplasm |
| Gene sequence | >lcl|BSEQ0021655|Mitogen-activated protein kinase 3 (MAPK3) ATGGCGGCGGCGGCGGCTCAGGGGGGCGGGGGCGGGGAGCCCCGTAGAACCGAGGGGGTC GGCCCGGGGGTCCCGGGGGAGGTGGAGATGGTGAAGGGGCAGCCGTTCGACGTGGGCCCG CGCTACACGCAGTTGCAGTACATCGGCGAGGGCGCGTACGGCATGGTCAGCTCGGCCTAT GACCACGTGCGCAAGACTCGCGTGGCCATCAAGAAGATCAGCCCCTTCGAACATCAGACC TACTGCCAGCGCACGCTCCGGGAGATCCAGATCCTGCTGCGCTTCCGCCATGAGAATGTC ATCGGCATCCGAGACATTCTGCGGGCGTCCACCCTGGAAGCCATGAGAGATGTCTACATT GTGCAGGACCTGATGGAGACTGACCTGTACAAGTTGCTGAAAAGCCAGCAGCTGAGCAAT GACCATATCTGCTACTTCCTCTACCAGATCCTGCGGGGCCTCAAGTACATCCACTCCGCC AACGTGCTCCACCGAGATCTAAAGCCCTCCAACCTGCTCATCAACACCACCTGCGACCTT AAGATTTGTGATTTCGGCCTGGCCCGGATTGCCGATCCTGAGCATGACCACACCGGCTTC CTGACGGAGTATGTGGCTACGCGCTGGTACCGGGCCCCAGAGATCATGCTGAACTCCAAG GGCTATACCAAGTCCATCGACATCTGGTCTGTGGGCTGCATTCTGGCTGAGATGCTCTCT AACCGGCCCATCTTCCCTGGCAAGCACTACCTGGATCAGCTCAACCACATTCTGGGCATC CTGGGCTCCCCATCCCAGGAGGACCTGAATTGTATCATCAACATGAAGGCCCGAAACTAC CTACAGTCTCTGCCCTCCAAGACCAAGGTGGCTTGGGCCAAGCTTTTCCCCAAGTCAGAC TCCAAAGCCCTTGACCTGCTGGACCGGATGTTAACCTTTAACCCCAATAAACGGATCACA GTGGAGGAAGCGCTGGCTCACCCCTACCTGGAGCAGTACTATGACCCGACGGATGAGGTG GGCCAGTCCCCAGCAGCAGTGGGGCTGGGGGCAGGGGAGCAGGGGGGCACGTAG |
| GenBank Gene ID | X60188 |
| GeneCard ID | None |
| GenAtlas ID | MAPK3 |
| HGNC ID | HGNC:6877 |
| Chromosome Location | 16 |
| Locus | 16p11.2 |
| References |
|
Related FRC
| FRCD ID | Name | Exact Mass | Structure |
|---|---|---|---|
2,2',4,4',5,5'-Hexachlorobiphenyl |
360.864 |
||
2,3,3',4,4',5-Hexachlorobiphenyl |
360.864 |
||
Maneb |
265.284 |
||
Cadmium |
112.414 |
||
Chromium |
51.996 |
||
Chromocene |
182.186 |