Alpha-synuclein
Name | Alpha-synuclein |
---|---|
Synonyms | NACP Non-A beta component of AD amyloid Non-A4 component of amyloid precursor PARK1 |
Gene Name | SNCA |
Organism | Human |
Amino acid sequence | >lcl|BSEQ0001750|Alpha-synuclein MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTK EQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDP DNEAYEMPSEEGYQDYEPEA |
Number of residues | 140 |
Molecular Weight | 14460.155 |
Theoretical pI | 4.37 |
GO Classification |
Functions
calcium ion binding alpha-tubulin binding Hsp70 protein binding phosphoprotein binding kinesin binding dynein binding oxidoreductase activity cysteine-type endopeptidase inhibitor activity involved in apoptotic process zinc ion binding phospholipid binding tau protein binding histone binding ferrous iron binding copper ion binding magnesium ion binding identical protein binding transcription regulatory region DNA binding Processes
cellular response to copper ion cellular response to fibroblast growth factor stimulus negative regulation of microtubule polymerization phospholipid metabolic process negative regulation of exocytosis synapse organization negative regulation of thrombin receptor signaling pathway regulation of locomotion behavioral response to cocaine response to magnesium ion cellular protein metabolic process negative regulation of histone acetylation aging response to interleukin-1 protein destabilization negative regulation of transporter activity positive regulation of endocytosis negative regulation of neuron apoptotic process negative regulation of platelet-derived growth factor receptor signaling pathway neutral lipid metabolic process oxidation-reduction process dopamine biosynthetic process negative regulation of serotonin uptake response to drug activation of cysteine-type endopeptidase activity involved in apoptotic process positive regulation of glutathione peroxidase activity adult locomotory behavior negative regulation of apoptotic process dopamine uptake involved in synaptic transmission regulation of synaptic vesicle recycling positive regulation of hydrogen peroxide catabolic process response to interferon-gamma negative regulation of cysteine-type endopeptidase activity involved in apoptotic process cellular response to epinephrine stimulus extracellular fibril organization positive regulation of neurotransmitter secretion excitatory postsynaptic potential regulation of acyl-CoA biosynthetic process positive regulation of peptidyl-serine phosphorylation positive regulation of inositol phosphate biosynthetic process regulation of dopamine secretion mitochondrial membrane organization negative regulation of dopamine metabolic process regulation of glutamate secretion cellular response to oxidative stress positive regulation of release of sequestered calcium ion into cytosol mitochondrial ATP synthesis coupled electron transport positive regulation of protein serine/threonine kinase activity negative regulation of dopamine uptake involved in synaptic transmission synaptic vesicle endocytosis regulation of phospholipase activity positive regulation of apoptotic process response to lipopolysaccharide response to iron(II) ion negative regulation of mitochondrial electron transport, NADH to ubiquinone regulation of macrophage activation regulation of long-term neuronal synaptic plasticity regulation of reactive oxygen species biosynthetic process receptor internalization negative regulation of transcription from RNA polymerase II promoter microglial cell activation negative regulation of protein phosphorylation negative regulation of monooxygenase activity fatty acid metabolic process positive regulation of receptor recycling long-term synaptic potentiation negative regulation of norepinephrine uptake Components
extracellular region synaptic vesicle nuclear outer membrane nucleus cell junction cell cortex fibril Golgi apparatus plasma membrane terminal bouton cytosol perinuclear region of cytoplasm cytoplasm extracellular space cytoplasmic vesicle membrane mitochondrion lysosome axon membrane inclusion body ribosome growth cone actin cytoskeleton rough endoplasmic reticulum |
General Function | None |
Specific Function | None |
Transmembrane Regions | |
GenBank Protein ID | 437365 |
UniProtKB ID | P37840 |
UniProtKB Entry Name | SYUA_HUMAN |
Cellular Location | Cytoplasm |
Gene sequence | >lcl|BSEQ0021281|Alpha-synuclein (SNCA) ATGGATGTATTCATGAAAGGACTTTCAAAGGCCAAGGAGGGAGTTGTGGCTGCTGCTGAG AAAACCAAACAGGGTGTGGCAGAAGCAGCAGGAAAGACAAAAGAGGGTGTTCTCTATGTA GGCTCCAAAACCAAGGAGGGAGTGGTGCATGGTGTGGCAACAGTGGCTGAGAAGACCAAA GAGCAAGTGACAAATGTTGGAGGAGCAGTGGTGACGGGTGTGACAGCAGTAGCCCAGAAG ACAGTGGAGGGAGCAGGGAGCATTGCAGCAGCCACTGGCTTTGTCAAAAAGGACCAGTTG GGCAAGAATGAAGAAGGAGCCCCACAGGAAGGAATTCTGGAAGATATGCCTGTGGATCCT GACAATGAGGCTTATGAAATGCCTTCTGAGGAAGGGTATCAAGACTACGAACCTGAAGCC TAA |
GenBank Gene ID | L08850 |
GeneCard ID | None |
GenAtlas ID | SNCA |
HGNC ID | HGNC:11138 |
Chromosome Location | None |
Locus | 4q21 |
References |
|
Related FRC
FRCD ID | Name | Exact Mass | Structure |
---|---|---|---|
Chlorophyllin |
618.973 |
||
Melatonin |
232.283 |
||
Dieldrin |
380.895 |
||
Acrolein |
56.064 |
||
Copper |
63.546 |