DNA-directed RNA polymerases I, II, and III subunit RPABC4
| Name | DNA-directed RNA polymerases I, II, and III subunit RPABC4 |
|---|---|
| Synonyms | ABC10-alpha DNA-directed RNA polymerase II subunit K RNA polymerase II 7.0 kDa subunit RNA polymerases I, II, and III subunit ABC4 RPB10alpha RPB7.0 |
| Gene Name | POLR2K |
| Organism | Human |
| Amino acid sequence | >lcl|BSEQ0013654|DNA-directed RNA polymerases I, II, and III subunit RPABC4 MDTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLVVFDAR |
| Number of residues | 58 |
| Molecular Weight | 7004.145 |
| Theoretical pI | None |
| GO Classification |
Functions
zinc ion binding DNA binding DNA-directed RNA polymerase activity Processes
gene silencing by RNA transcription elongation from RNA polymerase III promoter mRNA splicing, via spliceosome transcription from RNA polymerase I promoter piRNA metabolic process transcription from RNA polymerase III promoter innate immune response positive regulation of viral transcription transcription initiation from RNA polymerase I promoter somatic stem cell population maintenance RNA splicing DNA repair regulation of transcription from RNA polymerase I promoter transcription-coupled nucleotide-excision repair transcription elongation from RNA polymerase II promoter viral process nucleotide-excision repair negative regulation of gene expression, epigenetic transcription from RNA polymerase II promoter regulation of gene expression, epigenetic termination of RNA polymerase I transcription positive regulation of type I interferon production termination of RNA polymerase III transcription gene expression 7-methylguanosine mRNA capping transcription elongation from RNA polymerase I promoter transcription initiation from RNA polymerase II promoter Components
cytosol nucleoplasm nucleus DNA-directed RNA polymerase I complex DNA-directed RNA polymerase III complex DNA-directed RNA polymerase II, core complex |
| General Function | Zinc ion binding |
| Specific Function | DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I, II and III which synthesize ribosomal RNA precursors, mRNA precursors and many functional non-coding RNAs, and a small RNAs, such as 5S rRNA and tRNAs, respectively. |
| Transmembrane Regions | |
| GenBank Protein ID | |
| UniProtKB ID | P53803 |
| UniProtKB Entry Name | RPAB4_HUMAN |
| Cellular Location | Nucleus |
| Gene sequence | >lcl|BSEQ0013655|DNA-directed RNA polymerases I, II, and III subunit RPABC4 (POLR2K) ATGGACACCCAGAAGGACGTTCAACCTCCAAAGCAGCAACCAATGATATATATCTGTGGA GAGTGTCACACAGAAAATGAAATAAAATCTAGGGATCCAATCAGATGCAGAGAATGTGGA TACAGAATAATGTACAAGAAAAGGACTAAAAGATTGGTCGTTTTTGATGCTCGATGA |
| GenBank Gene ID | |
| GeneCard ID | None |
| GenAtlas ID | |
| HGNC ID | HGNC:9198 |
| Chromosome Location | 8 |
| Locus | None |
| References |
|
Related FRC
| FRCD ID | Name | Exact Mass | Structure |
|---|---|---|---|
Amanullin |
886.979 |
||
Amaninamide |
902.978 |
||
Amanin |
903.962 |
||
Proamanullin |
870.98 |
||
Patulin |
154.121 |
||
Luteoskyrin |
574.494 |