Ornithine decarboxylase antizyme 1


NameOrnithine decarboxylase antizyme 1
SynonymsOAZ ODC-Az
Gene NameOAZ1
OrganismHuman
Amino acid sequence
>lcl|BSEQ0037002|Ornithine decarboxylase antizyme 1
MVKSSLQRILNSHCFAREKEGDKPSATIHASRTMPLLSLHSRGGSSSESSRVSLHCCSNP
GPGPRWCSDAPHPPLKIPGGRGNSQRDHNLSANLFYSDDRLNVTEELTSNDKTRILNVQS
RLTDAKRINWRTVLSGGSLYIEIPGGALPEGSKDSFAVLLEFAEEQLRADHVFICFHKNR
EDRAALLRTFSFLGFEIVRPGHPLVPKRPDACFMAYTFERESSGEEEE
Number of residues228
Molecular Weight25405.265
Theoretical pI7.57
GO Classification
Functions
    ornithine decarboxylase inhibitor activity
Processes
    positive regulation of intracellular protein transport
    polyamine metabolic process
    polyamine biosynthetic process
    negative regulation of polyamine transmembrane transport
    positive regulation of protein catabolic process
    regulation of cellular amino acid metabolic process
    transport
    cellular nitrogen compound metabolic process
    small molecule metabolic process
Components
    cytosol
General FunctionOrnithine decarboxylase inhibitor activity
Specific FunctionOrnithine decarboxylase (ODC) antizyme protein that negatively regulates ODC activity and intracellular polyamine biosynthesis and uptake by binding to and targeting ODC1 for degradation (PubMed:17900240). Stabilizes AZIN2 by interfering with its ubiquitination. Also inhibits cellular uptake of polyamines by inactivating the polyamine uptake transporter. SMAD1/OAZ1/PSMB4 complex mediates the degradation of the CREBBP/EP300 repressor SNIP1. Involved in the translocation of AZNI2 from ER-Golgi intermediate compartment (ERGIC) to the cytosol.
Transmembrane Regions
GenBank Protein ID852429
UniProtKB IDP54368
UniProtKB Entry NameOAZ1_HUMAN
Cellular LocationNone
Gene sequence
>lcl|BSEQ0000738|681 bp
AATCCTCCCTGCAGCGGATCCTCAATAGCCACTGCTTCGCCAGAGAGAAGGAAGGGGATA
AACCCAGCGCCACCATCCACGCCAGCCGCACCATGCCGCTCCTTAGCCTGCACAGCCGCG
GCGGCAGCAGCAGTGAGAGTTCCAGGGTCTCCCTCCACTGCTGTAGTAACCCGGGTCCGG
GGCCTCGGTGGTGCTCCTGATGCCCCTCACCCACCCCTGAAGATCCCAGGTGGGCGAGGG
AATAGTCAGAGGGATCACAATCTTTCAGCTAACTTATTCTACTCCGATGATCGGCTGAAT
GTAACAGAGGAACTAACGTCCAACGACAAGACGAGGATTCTCAACGTCCAGTCCAGGCTC
ACAGACGCCAAACGCATTAACTGGCGAACAGTGCTGAGTGGCGGCAGCCTCTACATCGAG
ATCCCGGGCGGCGCGCTGCCCGAGGGGAGCAAGGACAGCTTTGCAGTTCTCCTGGAGTTC
GCTGAGGAGCAGCTGCGAGCCGACCATGTCTTCATTTGCTTCCACAAGAACCGCGAGGAC
AGAGCCGCCTTGCTCCGAACCTTCAGCTTTTTGGGCTTTGAGATTGTGAGACCGGGGCAT
CCCCTTGTCCCCAAGAGACCCGACGCTTGCTTCATGGCCTACACGTTCGAGAGAGAGTCT
TCGGGAGAGGAGGAGGAGTAG
GenBank Gene IDU09202
GeneCard IDNone
GenAtlas IDOAZ1
HGNC IDHGNC:8095
Chromosome LocationNone
Locus19p13.3
References
  1. Tewari DS, Qian Y, Thornton RD, Pieringer J, Taub R, Mochan E, Tewari M: Molecular cloning and sequencing of a human cDNA encoding ornithine decarboxylase antizyme. Biochim Biophys Acta. 1994 Dec 14;1209(2):293-5.[7811704 ]
  2. Yang D, Takii T, Hayashi H, Itoh S, Hayashi M, Onozaki K: Molcecular cloning of human antizyme cDNA. Biochem Mol Biol Int. 1996 Apr;38(5):957-64.[9132164 ]
  3. Hayashi T, Matsufuji S, Hayashi S: Characterization of the human antizyme gene. Gene. 1997 Dec 12;203(2):131-9.[9426243 ]
  4. Lin Y, Martin J, Gruendler C, Farley J, Meng X, Li BY, Lechleider R, Huff C, Kim RH, Grasser WA, Paralkar V, Wang T: A novel link between the proteasome pathway and the signal transduction pathway of the bone morphogenetic proteins (BMPs). BMC Cell Biol. 2002 Jun 21;3:15.[12097147 ]
  5. Kanerva K, Makitie LT, Pelander A, Heiskala M, Andersson LC: Human ornithine decarboxylase paralogue (ODCp) is an antizyme inhibitor but not an arginine decarboxylase. Biochem J. 2008 Jan 1;409(1):187-92.[17900240 ]
  6. Grimwood J, Gordon LA, Olsen A, Terry A, Schmutz J, Lamerdin J, Hellsten U, Goodstein D, Couronne O, Tran-Gyamfi M, Aerts A, Altherr M, Ashworth L, Bajorek E, Black S, Branscomb E, Caenepeel S, Carrano A, Caoile C, Chan YM, Christensen M, Cleland CA, Copeland A, Dalin E, Dehal P, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Garcia C, Georgescu AM, Glavina T, Gomez M, Gonzales E, Groza M, Hammon N, Hawkins T, Haydu L, Ho I, Huang W, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Larionov V, Leem SH, Lopez F, Lou Y, Lowry S, Malfatti S, Martinez D, McCready P, Medina C, Morgan J, Nelson K, Nolan M, Ovcharenko I, Pitluck S, Pollard M, Popkie AP, Predki P, Quan G, Ramirez L, Rash S, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, She X, Smith D, Slezak T, Solovyev V, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wagner M, Wheeler J, Wu K, Xie G, Yang J, Dubchak I, Furey TS, DeJong P, Dickson M, Gordon D, Eichler EE, Pennacchio LA, Richardson P, Stubbs L, Rokhsar DS, Myers RM, Rubin EM, Lucas SM: The DNA sequence and biology of human chromosome 19. Nature. 2004 Apr 1;428(6982):529-35.[15057824 ]

Related FRC


FRCD ID Name Exact Mass Structure



Ornithine




132.163