Basic phospholipase A2 VRV-PL-VIIIa

NameBasic phospholipase A2 VRV-PL-VIIIa
Synonyms3.1.1.4 DPLA2 P1 Phosphatidylcholine 2-acylhydrolase Phospholipase A2 4 PLA24 svPLA2
Gene NameNone
OrganismRussel's viper
Amino acid sequence
>lcl|BSEQ0013597|Basic phospholipase A2 VRV-PL-VIIIa
SLLEFGKMILEETGKLAIPSYSSYGCYCGWGGKGTPKDATDRCCFVHDCCYGNLPDCNPK
SDRYKYKRVNGAIVCEKGTSCENRICECDKAAAICFRQNLNTYSKKYMLYPDFLCKGELK
C
Number of residues121
Molecular Weight13610.55
Theoretical pINone
GO Classification
Functions
    calcium ion binding
phospholipase A2 activity
Processes
    phospholipid metabolic process
lipid catabolic process
Components
    other organism presynaptic membrane
extracellular region
General FunctionPhospholipase a2 activity
Specific FunctionSnake venom phospholipase A2 (PLA2) that shows weak neurotoxicity and medium anticoagulant effects by binding to factor Xa (F10) and inhibiting the prothrombinase activity (IC(50) is 130 nM) (PubMed:18062812). It also damages vital organs such as lung, liver and kidney, displays edema-inducing activities when injected into the foot pads of mice and induces necrosis of muscle cells when injected into the thigh muscle. Has a low enzymatic activity. PLA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides.
Transmembrane Regions
GenBank Protein ID
UniProtKB IDP59071
UniProtKB Entry NamePA2B8_DABRR
Cellular LocationSecreted
Gene sequence
None
GenBank Gene ID
GeneCard IDNone
GenAtlas ID
HGNC ID
Chromosome LocationNone
LocusNone
References
  1. Kasturi S, Rudrammaji LM, Gowda TV: Antibodies to a phospholipase A2 from Vipera russelli selectively neutralize venom neurotoxicity. Immunology. 1990 Jun;70(2):175-80.[2115497 ]
  2. Gowda VT, Schmidt J, Middlebrook JL: Primary sequence determination of the most basic myonecrotic phospholipase A2 from the venom of Vipera russelli. Toxicon. 1994 Jun;32(6):665-73.[7940574 ]
  3. Tsai IH, Lu PJ, Su JC: Two types of Russell's viper revealed by variation in phospholipases A2 from venom of the subspecies. Toxicon. 1996 Jan;34(1):99-109.[8835338 ]
  4. Suzuki M, Itoh T, Anuruddhe BM, Bandaranayake IK, Shirani Ranasinghe JG, Athauda SB, Moriyama A: Molecular diversity in venom proteins of the Russell's viper (Daboia russellii russellii) and the Indian cobra (Naja naja) in Sri Lanka. Biomed Res. 2010 Feb;31(1):71-81.[20203422 ]
  5. Kasturi S, Gowda TV: Purification and characterization of a major phospholipase A2 from Russell's viper (Vipera russelli) venom. Toxicon. 1989;27(2):229-37.[2718191 ]
  6. Faure G, Gowda VT, Maroun RC: Characterization of a human coagulation factor Xa-binding site on Viperidae snake venom phospholipases A2 by affinity binding studies and molecular bioinformatics. BMC Struct Biol. 2007 Dec 6;7:82.[18062812 ]
  7. Chandra V, Kaur P, Srinivasan A, Singh TP: Three-dimensional structure of a presynaptic neurotoxic phospholipase A2 from Daboia russelli pulchella at 2.4 A resolution. J Mol Biol. 2000 Mar 3;296(4):1117-26.[10686108 ]
  8. Chandra V, Kaur P, Jasti J, Betzel C, Singh TP: Regulation of catalytic function by molecular association: structure of phospholipase A2 from Daboia russelli pulchella (DPLA2) at 1.9 A resolution. Acta Crystallogr D Biol Crystallogr. 2001 Dec;57(Pt 12):1793-8. Epub 2001 Nov 21.[11717491 ]
  9. Chandra V, Jasti J, Kaur P, Dey S, Srinivasan A, Betzel Ch, Singh TP: Design of specific peptide inhibitors of phospholipase A2: structure of a complex formed between Russell's viper phospholipase A2 and a designed peptide Leu-Ala-Ile-Tyr-Ser (LAIYS). Acta Crystallogr D Biol Crystallogr. 2002 Oct;58(Pt 10 Pt 2):1813-9. Epub 2002 Sep 28.[12351825 ]
  10. Chandra V, Jasti J, Kaur P, Srinivasan A, Betzel Ch, Singh TP: Structural basis of phospholipase A2 inhibition for the synthesis of prostaglandins by the plant alkaloid aristolochic acid from a 1.7 A crystal structure. Biochemistry. 2002 Sep 10;41(36):10914-9.[12206661 ]
  11. Chandra V, Jasti J, Kaur P, Dey S, Perbandt M, Srinivasan A, Betzel Ch, Singh TP: Crystal structure of a complex formed between a snake venom phospholipase A(2) and a potent peptide inhibitor Phe-Leu-Ser-Tyr-Lys at 1.8 A resolution. J Biol Chem. 2002 Oct 25;277(43):41079-85. Epub 2002 Aug 16.[12186870 ]

Related FRC

FRCD ID Name Exact Mass Structure




F04772



Aspirin


180.159