Interleukin-2
| Name | Interleukin-2 |
|---|---|
| Synonyms | IL-2 T-cell growth factor TCGF |
| Gene Name | IL2 |
| Organism | Human |
| Amino acid sequence | >lcl|BSEQ0002049|Interleukin-2 MYRMQLLSCIALSLALVTNSAPTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRML TFKFYMPKKATELKHLQCLEEELKPLEEVLNLAQSKNFHLRPRDLISNINVIVLELKGSE TTFMCEYADETATIVEFLNRWITFCQSIISTLT |
| Number of residues | 153 |
| Molecular Weight | 17627.52 |
| Theoretical pI | 7.95 |
| GO Classification |
Functions
interleukin-2 receptor binding glycosphingolipid binding kinase activator activity growth factor activity cytokine activity carbohydrate binding Processes
extrinsic apoptotic signaling pathway in absence of ligand fibroblast growth factor receptor signaling pathway regulation of T cell homeostatic proliferation positive regulation of inflammatory response small GTPase mediated signal transduction negative regulation of B cell apoptotic process insulin receptor signaling pathway negative regulation of inflammatory response cell-cell signaling MAPK cascade positive regulation of tyrosine phosphorylation of Stat5 protein negative regulation of heart contraction negative regulation of apoptotic process cell adhesion positive regulation of interferon-gamma production T cell differentiation neurotrophin TRK receptor signaling pathway positive regulation of immunoglobulin secretion axon guidance positive regulation of dendritic spine development positive regulation of transcription from RNA polymerase II promoter adaptive immune response epidermal growth factor receptor signaling pathway positive regulation of activated T cell proliferation Ras protein signal transduction natural killer cell activation innate immune response positive regulation of interleukin-17 production vascular endothelial growth factor receptor signaling pathway immune response positive regulation of B cell proliferation positive regulation of cytosolic calcium ion concentration positive regulation of tissue remodeling positive regulation of cell growth positive regulation of isotype switching to IgG isotypes Fc-epsilon receptor signaling pathway negative regulation of lymphocyte proliferation positive regulation of cell proliferation negative regulation of protein phosphorylation activation of MAPKK activity positive regulation of regulatory T cell differentiation protein kinase C-activating G-protein coupled receptor signaling pathway Components
intracellular cytosol extracellular region extracellular space |
| General Function | Kinase activator activity |
| Specific Function | Produced by T-cells in response to antigenic or mitogenic stimulation, this protein is required for T-cell proliferation and other activities crucial to regulation of the immune response. Can stimulate B-cells, monocytes, lymphokine-activated killer cells, natural killer cells, and glioma cells. |
| Transmembrane Regions | |
| GenBank Protein ID | 5729676 |
| UniProtKB ID | P60568 |
| UniProtKB Entry Name | IL2_HUMAN |
| Cellular Location | Secreted |
| Gene sequence | >lcl|BSEQ0016290|Interleukin-2 (IL2) ATGTACAGGATGCAACTCCTGTCTTGCATTGCACTAAGTCTTGCACTTGTCACAAACAGT GCACCTACTTCAAGTTCTACAAAGAAAACACAGCTACAACTGGAGCATTTACTGCTGGAT TTACAGATGATTTTGAATGGAATTAATAATTACAAGAATCCCAAACTCACCAGGATGCTC ACATTTAAGTTTTACATGCCCAAGAAGGCCACAGAACTGAAACATCTTCAGTGTCTAGAA GAAGAACTCAAACCTCTGGAGGAAGTGCTAAATTTAGCTCAAAGCAAAAACTTTCACTTA AGACCCAGGGACTTAATCAGCAATATCAACGTAATAGTTCTGGAACTAAAGGGATCTGAA ACAACATTCATGTGTGAATATGCTGATGAGACAGCAACCATTGTAGAATTTCTGAACAGA TGGATTACCTTTTGTCAAAGCATCATCTCAACACTGACTTGA |
| GenBank Gene ID | J00264 |
| GeneCard ID | None |
| GenAtlas ID | IL2 |
| HGNC ID | HGNC:6001 |
| Chromosome Location | 4 |
| Locus | 4q26-q27 |
| References |
|
Related FRC
| FRCD ID | Name | Exact Mass | Structure |
|---|---|---|---|
Pseudoephedrine |
165.23 |