DNA-directed RNA polymerases I, II, and III subunit RPABC2
| Name | DNA-directed RNA polymerases I, II, and III subunit RPABC2 |
|---|---|
| Synonyms | DNA-directed RNA polymerase II subunit F DNA-directed RNA polymerases I, II, and III 14.4 kDa polypeptide POLRF RNA polymerases I, II, and III subunit ABC2 RPABC14.4 RPB14.4 RPB6 homolog RPC15 |
| Gene Name | POLR2F |
| Organism | Human |
| Amino acid sequence | >lcl|BSEQ0013575|DNA-directed RNA polymerases I, II, and III subunit RPABC2 MSDNEDNFDGDDFDDVEEDEGLDDLENAEEEGQENVEILPSGERPQANQKRITTPYMTKY ERARVLGTRALQIAMCAPVMVELEGETDPLLIAMKELKARKIPIIIRRYLPDGSYEDWGV DELIITD |
| Number of residues | 127 |
| Molecular Weight | 14477.92 |
| Theoretical pI | None |
| GO Classification |
Functions
DNA binding DNA-directed RNA polymerase activity Processes
transcription from RNA polymerase II promoter negative regulation of gene expression, epigenetic regulation of gene expression, epigenetic termination of RNA polymerase I transcription gene expression positive regulation of type I interferon production termination of RNA polymerase III transcription transcription initiation from RNA polymerase II promoter 7-methylguanosine mRNA capping transcription elongation from RNA polymerase I promoter gene silencing by RNA transcription elongation from RNA polymerase III promoter mRNA splicing, via spliceosome transcription from RNA polymerase I promoter piRNA metabolic process transcription from RNA polymerase III promoter innate immune response positive regulation of viral transcription DNA repair transcription initiation from RNA polymerase I promoter somatic stem cell population maintenance RNA splicing transcription-coupled nucleotide-excision repair transcription elongation from RNA polymerase II promoter nucleotide-excision repair viral process Components
DNA-directed RNA polymerase I complex DNA-directed RNA polymerase III complex DNA-directed RNA polymerase II, core complex cytosol nucleolus nucleoplasm nucleus |
| General Function | Dna-directed rna polymerase activity |
| Specific Function | DNA-dependent RNA polymerases catalyze the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I, II, and III which synthesize ribosomal RNA precursors, mRNA precursors and many functional non-coding RNAs, and small RNAs, such as 5S rRNA and tRNAs, respectively. Pol II is the central component of the basal RNA polymerase II transcription machinery. Pols are composed of mobile elements that move relative to each other. In Pol II, POLR2F/RPB6 is part of the clamp element and together with parts of RPB1 and RPB2 forms a pocket to which the RPB4-RPB7 subcomplex binds (By similarity). |
| Transmembrane Regions | |
| GenBank Protein ID | |
| UniProtKB ID | P61218 |
| UniProtKB Entry Name | RPAB2_HUMAN |
| Cellular Location | Nucleus |
| Gene sequence | None |
| GenBank Gene ID | |
| GeneCard ID | None |
| GenAtlas ID | |
| HGNC ID | HGNC:9193 |
| Chromosome Location | None |
| Locus | None |
| References |
|
Related FRC
| FRCD ID | Name | Exact Mass | Structure |
|---|---|---|---|
Amanullin |
886.979 |
||
Amaninamide |
902.978 |
||
Amanin |
903.962 |
||
Proamanullin |
870.98 |
||
Patulin |
154.121 |
||
Luteoskyrin |
574.494 |