DNA-directed RNA polymerases I, II, and III subunit RPABC2

NameDNA-directed RNA polymerases I, II, and III subunit RPABC2
SynonymsDNA-directed RNA polymerase II subunit F DNA-directed RNA polymerases I, II, and III 14.4 kDa polypeptide POLRF RNA polymerases I, II, and III subunit ABC2 RPABC14.4 RPB14.4 RPB6 homolog RPC15
Gene NamePOLR2F
OrganismHuman
Amino acid sequence
>lcl|BSEQ0013575|DNA-directed RNA polymerases I, II, and III subunit RPABC2
MSDNEDNFDGDDFDDVEEDEGLDDLENAEEEGQENVEILPSGERPQANQKRITTPYMTKY
ERARVLGTRALQIAMCAPVMVELEGETDPLLIAMKELKARKIPIIIRRYLPDGSYEDWGV
DELIITD
Number of residues127
Molecular Weight14477.92
Theoretical pINone
GO Classification
Functions
    DNA binding
DNA-directed RNA polymerase activity
Processes
    transcription from RNA polymerase II promoter
negative regulation of gene expression, epigenetic
regulation of gene expression, epigenetic
termination of RNA polymerase I transcription
gene expression
positive regulation of type I interferon production
termination of RNA polymerase III transcription
transcription initiation from RNA polymerase II promoter
7-methylguanosine mRNA capping
transcription elongation from RNA polymerase I promoter
gene silencing by RNA
transcription elongation from RNA polymerase III promoter
mRNA splicing, via spliceosome
transcription from RNA polymerase I promoter
piRNA metabolic process
transcription from RNA polymerase III promoter
innate immune response
positive regulation of viral transcription
DNA repair
transcription initiation from RNA polymerase I promoter
somatic stem cell population maintenance
RNA splicing
transcription-coupled nucleotide-excision repair
transcription elongation from RNA polymerase II promoter
nucleotide-excision repair
viral process
Components
    DNA-directed RNA polymerase I complex
DNA-directed RNA polymerase III complex
DNA-directed RNA polymerase II, core complex
cytosol
nucleolus
nucleoplasm
nucleus
General FunctionDna-directed rna polymerase activity
Specific FunctionDNA-dependent RNA polymerases catalyze the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I, II, and III which synthesize ribosomal RNA precursors, mRNA precursors and many functional non-coding RNAs, and small RNAs, such as 5S rRNA and tRNAs, respectively. Pol II is the central component of the basal RNA polymerase II transcription machinery. Pols are composed of mobile elements that move relative to each other. In Pol II, POLR2F/RPB6 is part of the clamp element and together with parts of RPB1 and RPB2 forms a pocket to which the RPB4-RPB7 subcomplex binds (By similarity).
Transmembrane Regions
GenBank Protein ID
UniProtKB IDP61218
UniProtKB Entry NameRPAB2_HUMAN
Cellular LocationNucleus
Gene sequence
None
GenBank Gene ID
GeneCard IDNone
GenAtlas ID
HGNC IDHGNC:9193
Chromosome LocationNone
LocusNone
References
  1. Acker J, Wintzerith M, Vigneron M, Kedinger C: A 14.4 KDa acidic subunit of human RNA polymerase II with a putative leucine-zipper. DNA Seq. 1994;4(5):329-31.[7803819 ]
  2. Pusch C, Wang Z, Roe B, Blin N: Genomic structure of the RNA polymerase II small subunit (hRPB14.4) locus (POLRF) and mapping to 22q13.1 by sequence identity. Genomics. 1996 Jun 15;34(3):440-2.[8786150 ]
  3. Collins JE, Wright CL, Edwards CA, Davis MP, Grinham JA, Cole CG, Goward ME, Aguado B, Mallya M, Mokrab Y, Huckle EJ, Beare DM, Dunham I: A genome annotation-driven approach to cloning the human ORFeome. Genome Biol. 2004;5(10):R84. Epub 2004 Sep 30.[15461802 ]
  4. Dunham I, Shimizu N, Roe BA, Chissoe S, Hunt AR, Collins JE, Bruskiewich R, Beare DM, Clamp M, Smink LJ, Ainscough R, Almeida JP, Babbage A, Bagguley C, Bailey J, Barlow K, Bates KN, Beasley O, Bird CP, Blakey S, Bridgeman AM, Buck D, Burgess J, Burrill WD, O'Brien KP, et al.: The DNA sequence of human chromosome 22. Nature. 1999 Dec 2;402(6761):489-95.[10591208 ]
  5. Kershnar E, Wu SY, Chiang CM: Immunoaffinity purification and functional characterization of human transcription factor IIH and RNA polymerase II from clonal cell lines that conditionally express epitope-tagged subunits of the multiprotein complexes. J Biol Chem. 1998 Dec 18;273(51):34444-53.[9852112 ]
  6. Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M: Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis. Sci Signal. 2010 Jan 12;3(104):ra3. doi: 10.1126/scisignal.2000475.[20068231 ]
  7. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22.[24275569 ]
  8. del Rio-Portilla F, Gaskell A, Gilbert D, Ladias JA, Wagner G: Solution structure of the hRPABC14.4 subunit of human RNA polymerases. Nat Struct Biol. 1999 Nov;6(11):1039-42.[10542096 ]
  9. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7.[16959974 ]
  10. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7.[15489334 ]

Related FRC

FRCD ID Name Exact Mass Structure




F04867



Amanullin


886.979




F04869



Amaninamide


902.978




F04870



Amanin


903.962




F04871



Proamanullin


870.98




F04913



Patulin


154.121




F05011



Luteoskyrin


574.494