G-protein coupled estrogen receptor 1
| Name | G-protein coupled estrogen receptor 1 |
|---|---|
| Synonyms | CEPR Chemoattractant receptor-like 2 CMKRL2 DRY12 FEG-1 Flow-induced endothelial G-protein coupled receptor 1 G protein-coupled estrogen receptor 1 G-protein coupled receptor 30 GPCR-Br GPER GPR30 IL8-related receptor DRY12 LYGPR Lymphocyte-derived G-protein coupled receptor Membrane estrogen receptor mER |
| Gene Name | GPER1 |
| Organism | Human |
| Amino acid sequence | >lcl|BSEQ0020690|G-protein coupled estrogen receptor 1 MDVTSQARGVGLEMYPGTAQPAAPNTTSPELNLSHPLLGTALANGTGELSEHQQYVIGLF LSCLYTIFLFPIGFVGNILILVVNISFREKMTIPDLYFINLAVADLILVADSLIEVFNLH ERYYDIAVLCTFMSLFLQVNMYSSVFFLTWMSFDRYIALARAMRCSLFRTKHHARLSCGL IWMASVSATLVPFTAVHLQHTDEACFCFADVREVQWLEVTLGFIVPFAIIGLCYSLIVRV LVRAHRHRGLRPRRQKALRMILAVVLVFFVCWLPENVFISVHLLQRTQPGAAPCKQSFRH AHPLTGHIVNLAAFSNSCLNPLIYSFLGETFRDKLRLYIEQKTNLPALNRFCHAALKAVI PDSTEQSDVRFSSAV |
| Number of residues | 375 |
| Molecular Weight | 42247.12 |
| Theoretical pI | 8.36 |
| GO Classification |
Functions
chromatin binding steroid hormone binding drug binding G-protein coupled receptor activity estrogen receptor activity steroid binding mineralocorticoid receptor activity Processes
positive regulation of uterine smooth muscle contraction intracellular steroid hormone receptor signaling pathway positive regulation of cytosolic calcium ion concentration negative regulation of cell cycle process cytosolic calcium ion homeostasis negative regulation of ERK1 and ERK2 cascade neuronal action potential cellular response to mineralocorticoid stimulus positive regulation of protein phosphorylation positive regulation of inositol trisphosphate biosynthetic process negative regulation of DNA metabolic process positive regulation of cell proliferation cellular response to peptide hormone stimulus inflammatory response positive regulation of ERK1 and ERK2 cascade negative regulation of leukocyte activation positive regulation of phosphatidylinositol 3-kinase signaling negative regulation of cell cycle arrest cell cycle negative regulation of fat cell differentiation cellular response to tumor necrosis factor positive regulation of insulin secretion negative regulation of lipid biosynthetic process positive regulation of release of sequestered calcium ion into cytosol positive regulation of gene expression positive regulation of endothelial cell apoptotic process positive regulation of cell migration positive regulation of vasodilation negative regulation of vascular smooth muscle cell proliferation positive regulation of adenylate cyclase activity involved in G-protein coupled receptor signaling pathway negative regulation of protein kinase B signaling negative regulation of gene expression steroid hormone mediated signaling pathway negative regulation of cell proliferation cellular response to estradiol stimulus nuclear fragmentation involved in apoptotic nuclear change apoptotic chromosome condensation positive regulation of transcription from RNA polymerase II promoter positive regulation of cysteine-type endopeptidase activity involved in apoptotic process positive regulation of cardiac vascular smooth muscle cell differentiation negative regulation of inflammatory response positive regulation of establishment of protein localization to plasma membrane positive regulation of MAPK cascade positive regulation of neurotransmitter secretion positive regulation of cAMP biosynthetic process positive regulation of extrinsic apoptotic signaling pathway positive regulation of neurogenesis innate immune response positive regulation of epidermal growth factor receptor signaling pathway cellular response to glucose stimulus positive regulation of G-protein coupled receptor protein signaling pathway positive regulation of apoptotic process positive regulation of release of cytochrome c from mitochondria G-protein coupled receptor signaling pathway mineralocorticoid receptor signaling pathway Components
nuclear envelope axon endoplasmic reticulum membrane integral component of plasma membrane early endosome presynaptic membrane intracellular dendritic shaft mitochondrial membrane cytoplasm cell junction postsynaptic density keratin filament Golgi apparatus presynaptic active zone nucleus cytosol Golgi membrane trans-Golgi network perinuclear region of cytoplasm cytoplasmic vesicle membrane axon terminus dendritic spine head dendritic spine membrane endoplasmic reticulum recycling endosome dendrite plasma membrane neuronal postsynaptic density |
| General Function | Steroid hormone binding |
| Specific Function | G-protein coupled estrogen receptor that binds to 17-beta-estradiol (E2) with high affinity, leading to rapid and transient activation of numerous intracellular signaling pathways. Stimulates cAMP production, calcium mobilization and tyrosine kinase Src inducing the release of heparin-bound epidermal growth factor (HB-EGF) and subsequent transactivation of the epidermal growth factor receptor (EGFR), activating downstream signaling pathways such as PI3K/Akt and ERK/MAPK. Mediates pleiotropic functions among others in the cardiovascular, endocrine, reproductive, immune and central nervous systems. Has a role in cardioprotection by reducing cardiac hypertrophy and perivascular fibrosis in a RAMP3-dependent manner. Regulates arterial blood pressure by stimulating vasodilation and reducing vascular smooth muscle and microvascular endothelial cell proliferation. Plays a role in blood glucose homeostasis contributing to the insulin secretion response by pancreatic beta cells. Triggers mitochondrial apoptosis during pachytene spermatocyte differentiation. Stimulates uterine epithelial cell proliferation. Enhances uterine contractility in response to oxytocin. Contributes to thymic atrophy by inducing apoptosis. Attenuates TNF-mediated endothelial expression of leukocyte adhesion molecules. Promotes neuritogenesis in developing hippocampal neurons. Plays a role in acute neuroprotection against NMDA-induced excitotoxic neuronal death. Increases firing activity and intracellular calcium oscillations in luteinizing hormone-releasing hormone (LHRH) neurons. Inhibits early osteoblast proliferation at growth plate during skeletal development. Inhibits mature adipocyte differentiation and lipid accumulation. Involved in the recruitment of beta-arrestin 2 ARRB2 at the plasma membrane in epithelial cells. Functions also as a receptor for aldosterone mediating rapid regulation of vascular contractibility through the PI3K/ERK signaling pathway. Involved in cancer progression regulation. Stimulates cancer-associated fibroblast (CAF) proliferation by a rapid genomic response through the EGFR/ERK transduction pathway. Associated with EGFR, may act as a transcription factor activating growth regulatory genes (c-fos, cyclin D1). Promotes integrin alpha-5/beta-1 and fibronectin (FN) matrix assembly in breast cancer cells. |
| Transmembrane Regions | 63-84 97-120 133-153 176-194 221-236 260-280 307-327 |
| GenBank Protein ID | |
| UniProtKB ID | Q99527 |
| UniProtKB Entry Name | GPER1_HUMAN |
| Cellular Location | Nucleus |
| Gene sequence | >lcl|BSEQ0020691|G-protein coupled estrogen receptor 1 (GPER1) ATGGATGTGACTTCCCAAGCCCGGGGCGTGGGCCTGGAGATGTACCCAGGCACCGCGCAG CCTGCGGCCCCCAACACCACCTCCCCCGAGCTCAACCTGTCCCACCCGCTCCTGGGCACC GCCCTGGCCAATGGGACAGGTGAGCTCTCGGAGCACCAGCAGTACGTGATCGGCCTGTTC CTCTCGTGCCTCTACACCATCTTCCTCTTCCCCATCGGCTTTGTGGGCAACATCCTGATC CTGGTGGTGAACATCAGCTTCCGCGAGAAGATGACCATCCCCGACCTGTACTTCATCAAC CTGGCGGTGGCGGACCTCATCCTGGTGGCCGACTCCCTCATTGAGGTGTTCAACCTGCAC GAGCGGTACTACGACATCGCCGTCCTGTGCACCTTCATGTCGCTCTTCCTGCAGGTCAAC ATGTACAGCAGCGTCTTCTTCCTCACCTGGATGAGCTTCGACCGCTACATCGCCCTGGCC AGGGCCATGCGCTGCAGCCTGTTCCGCACCAAGCACCACGCCCGGCTGAGCTGTGGCCTC ATCTGGATGGCATCCGTGTCAGCCACGCTGGTGCCCTTCACCGCCGTGCACCTGCAGCAC ACCGACGAGGCCTGCTTCTGTTTCGCGGATGTCCGGGAGGTGCAGTGGCTCGAGGTCACG CTGGGCTTCATCGTGCCCTTCGCCATCATCGGCCTGTGCTACTCCCTCATTGTCCGGGTG CTGGTCAGGGCGCACCGGCACCGTGGGCTGCGGCCCCGGCGGCAGAAGGCGCTCCGCATG ATCCTCGCGGTGGTGCTGGTCTTCTTCGTCTGCTGGCTGCCGGAGAACGTCTTCATCAGC GTGCACCTCCTGCAGCGGACGCAGCCTGGGGCCGCTCCCTGCAAGCAGTCTTTCCGCCAT GCCCACCCCCTCACGGGCCACATTGTCAACCTCGCCGCCTTCTCCAACAGCTGCCTAAAC CCCCTCATCTACAGCTTTCTCGGGGAGACCTTCAGGGACAAGCTGAGGCTGTACATTGAG CAGAAAACAAATTTGCCGGCCCTGAACCGCTTCTGTCACGCTGCCCTGAAGGCCGTCATT CCAGACAGCACCGAGCAGTCGGATGTGAGGTTCAGCAGTGCCGTGTAG |
| GenBank Gene ID | BC011634 |
| GeneCard ID | None |
| GenAtlas ID | GPER |
| HGNC ID | HGNC:4485 |
| Chromosome Location | 7 |
| Locus | None |
| References |
|
Related FRC
| FRCD ID | Name | Exact Mass | Structure |
|---|---|---|---|
Clofenotane |
354.476 |
||
Chlordecone |
490.609 |
||
Bisphenol A |
228.291 |
||
(S,E)-Zearalenone |
318.369 |
||
Genistein |
270.24 |
||
4-Nonylphenol |
220.356 |