Ig gamma-4 chain C region

Name	Ig gamma-4 chain C region
Synonyms
Gene Name	IGHG4
Organism	Human
Amino acid sequence	>lcl\|BSEQ0008855\|Ig gamma-4 chain C region ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS GLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPSCPAPEFLGGPSV FLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTY RVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTK NQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEG NVFSCSVMHEALHNHYTQKSLSLSLGK
Number of residues	327
Molecular Weight	35940.34
Theoretical pI	None
GO Classification	Functions antigen binding immunoglobulin receptor binding Processes receptor-mediated endocytosis defense response to bacterium phagocytosis, engulfment B cell receptor signaling pathway complement activation complement activation, classical pathway Fc-gamma receptor signaling pathway involved in phagocytosis innate immune response phagocytosis, recognition Fc-epsilon receptor signaling pathway positive regulation of B cell activation Components blood microparticle extracellular region extracellular space extracellular exosome immunoglobulin complex, circulating external side of plasma membrane
General Function	Immunoglobulin receptor binding
Specific Function	None
Transmembrane Regions
GenBank Protein ID
UniProtKB ID	P01861
UniProtKB Entry Name	IGHG4_HUMAN
Cellular Location	Secreted
Gene sequence	None
GenBank Gene ID
GeneCard ID	None
GenAtlas ID
HGNC ID	HGNC:5528
Chromosome Location	None
Locus	None
References	Ellison J, Buxbaum J, Hood L: Nucleotide sequence of a human immunoglobulin C gamma 4 gene. DNA. 1981;1(1):11-8.[6299662 ] Heilig R, Eckenberg R, Petit JL, Fonknechten N, Da Silva C, Cattolico L, Levy M, Barbe V, de Berardinis V, Ureta-Vidal A, Pelletier E, Vico V, Anthouard V, Rowen L, Madan A, Qin S, Sun H, Du H, Pepin K, Artiguenave F, Robert C, Cruaud C, Bruls T, Jaillon O, Friedlander L, Samson G, Brottier P, Cure S, Segurens B, Aniere F, Samain S, Crespeau H, Abbasi N, Aiach N, Boscus D, Dickhoff R, Dors M, Dubois I, Friedman C, Gouyvenoux M, James R, Madan A, Mairey-Estrada B, Mangenot S, Martins N, Menard M, Oztas S, Ratcliffe A, Shaffer T, Trask B, Vacherie B, Bellemere C, Belser C, Besnard-Gonnet M, Bartol-Mavel D, Boutard M, Briez-Silla S, Combette S, Dufosse-Laurent V, Ferron C, Lechaplais C, Louesse C, Muselet D, Magdelenat G, Pateau E, Petit E, Sirvain-Trukniewicz P, Trybou A, Vega-Czarny N, Bataille E, Bluet E, Bordelais I, Dubois M, Dumont C, Guerin T, Haffray S, Hammadi R, Muanga J, Pellouin V, Robert D, Wunderle E, Gauguet G, Roy A, Sainte-Marthe L, Verdier J, Verdier-Discala C, Hillier L, Fulton L, McPherson J, Matsuda F, Wilson R, Scarpelli C, Gyapay G, Wincker P, Saurin W, Quetier F, Waterston R, Hood L, Weissenbach J: The DNA sequence and analysis of human chromosome 14. Nature. 2003 Feb 6;421(6923):601-7. Epub 2003 Jan 1.[12508121 ] Pink JR, Buttery SH, De Vries GM, Milstein C: Human immunoglobulin subclasses. Partial amino acid sequence of the constant region of a gamma 4 chain. Biochem J. 1970 Mar;117(1):33-47.[4192699 ] Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res. 2009 Feb;8(2):651-61. doi: 10.1021/pr8008012.[19159218 ] Jia W, Lu Z, Fu Y, Wang HP, Wang LH, Chi H, Yuan ZF, Zheng ZB, Song LN, Han HH, Liang YM, Wang JL, Cai Y, Zhang YK, Deng YL, Ying WT, He SM, Qian XH: A strategy for precise and large scale identification of core fucosylated glycoproteins. Mol Cell Proteomics. 2009 May;8(5):913-23. doi: 10.1074/mcp.M800504-MCP200. Epub 2009 Jan 12.[19139490 ]

From www.t3db.ca