Ig mu chain C region

NameIg mu chain C region
Synonyms
Gene NameIGHM
OrganismHuman
Amino acid sequence
>lcl|BSEQ0008862|Ig mu chain C region
GSASAPTLFPLVSCENSPSDTSSVAVGCLAQDFLPDSITLSWKYKNNSDISSTRGFPSVL
RGGKYAATSQVLLPSKDVMQGTDEHVVCKVQHPNGNKEKNVPLPVIAELPPKVSVFVPPR
DGFFGNPRKSKLICQATGFSPRQIQVSWLREGKQVGSGVTTDQVQAEAKESGPTTYKVTS
TLTIKESDWLGQSMFTCRVDHRGLTFQQNASSMCVPDQDTAIRVFAIPPSFASIFLTKST
KLTCLVTDLTTYDSVTISWTRQNGEAVKTHTNISESHPNATFSAVGEASICEDDWNSGER
FTCTVTHTDLPSPLKQTISRPKGVALHRPDVYLLPPAREQLNLRESATITCLVTGFSPAD
VFVQWMQRGQPLSPEKYVTSAPMPEPQAPGRYFAHSILTVSEEEWNTGETYTCVAHEALP
NRVTERTVDKSTGKPTLYNVSLVMSDTAGTCY
Number of residuesNone
Molecular Weight49306.215
Theoretical pINone
GO Classification
Functions
  • antigen binding
Processes
  • phagocytosis, engulfment
  • defense response to Gram-negative bacterium
  • adaptive immune response
  • B cell receptor signaling pathway
  • antibacterial humoral response
  • Fc-gamma receptor signaling pathway involved in phagocytosis
  • complement activation, classical pathway
  • innate immune response
  • phagocytosis, recognition
  • Fc-epsilon receptor signaling pathway
  • positive regulation of B cell activation
  • receptor-mediated endocytosis
Components
  • pentameric IgM immunoglobulin complex
  • plasma membrane
  • extracellular space
  • cell surface
  • integral component of membrane
  • extracellular exosome
  • external side of plasma membrane
  • hexameric IgM immunoglobulin complex
  • blood microparticle
General FunctionAntigen binding
Specific FunctionIgM antibodies play an important role in primary defense mechanisms. They have been shown to be involved in early recognition of external invaders like bacteria and viruses, cellular waste and modified self, as well as in recognition and elimination of precancerous and cancerous lesions. The membrane-bound form is found in the majority of normal B-cells alongside with IgD. Membrane-bound IgM induces the phosphorylation of CD79A and CD79B by the Src family of protein tyrosine kinases. It may cause death of cells by apoptosis. It is also found in soluble form, which represents about 30% of the total serum immunoglobulins where it is found almost exclusively as a homopentamer. After the antigen binds to the B-cell receptor, the secreted form is secreted in large amounts.
Transmembrane Regions
GenBank Protein ID
UniProtKB IDP01871
UniProtKB Entry Name
Cellular LocationSecreted
Gene sequence
None
GenBank Gene ID
GeneCard IDNone
GenAtlas ID
HGNC ID
Chromosome LocationNone
LocusNone
References
  1. Dorai H, Gillies SD: The complete nucleotide sequence of a human immunoglobulin genomic C mu gene. Nucleic Acids Res. 1989 Aug 11;17(15):6412. [2505237 ]
  2. Friedlander RM, Nussenzweig MC, Leder P: Complete nucleotide sequence of the membrane form of the human IgM heavy chain. Nucleic Acids Res. 1990 Jul 25;18(14):4278. [2115996 ]
  3. Watanabe S, Barnikol HU, Horn J, Bertram J, Hilschmann N: [The primary structure of a monoclonal IgM-immunoglobulin (macroglobulin Gal.), II: the amino acid sequence of the H-chain (mu-type), subgroup H III. Architecture of the complete IgM-molecule (author's transl)]. Hoppe Seylers Z Physiol Chem. 1973 Oct-Nov;354(10-11):1505-9. [4803843 ]
  4. Mihaesco E, Barnikol-Watanabe S, Barnikol HU, Mihaesco C, Hilschmann N: The primary structure of the constant part of mu-chain-disease protein BOT. Eur J Biochem. 1980 Oct;111(1):275-86. [6777162 ]
  5. Putnam FW, Florent G, Paul C, Shinoda T, Shimizu A: Complete amino acid sequence of the Mu heavy chain of a human IgM immunoglobulin. Science. 1973 Oct 19;182(4109):287-91. [4742735 ]
  6. Dolby TW, Devuono J, Croce CM: Cloning and partial nucleotide sequence of human immunoglobulin mu chain cDNA from B cells and mouse-human hybridomas. Proc Natl Acad Sci U S A. 1980 Oct;77(10):6027-31. [6777778 ]
  7. Rabbitts TH, Forster A, Milstein CP: Human immunoglobulin heavy chain genes: evolutionary comparisons of C mu, C delta and C gamma genes and associated switch sequences. Nucleic Acids Res. 1981 Sep 25;9(18):4509-24. [6795593 ]
  8. Tisch R, Roifman CM, Hozumi N: Functional differences between immunoglobulins M and D expressed on the surface of an immature B-cell line. Proc Natl Acad Sci U S A. 1988 Sep;85(18):6914-8. [3137579 ]
  9. Yel L, Minegishi Y, Coustan-Smith E, Buckley RH, Trubel H, Pachman LM, Kitchingman GR, Campana D, Rohrer J, Conley ME: Mutations in the mu heavy-chain gene in patients with agammaglobulinemia. N Engl J Med. 1996 Nov 14;335(20):1486-93. [8890099 ]
  10. Geisberger R, Lamers M, Achatz G: The riddle of the dual expression of IgM and IgD. Immunology. 2006 Aug;118(4):429-37. [16895553 ]
  11. Bunkenborg J, Pilch BJ, Podtelejnikov AV, Wisniewski JR: Screening for N-glycosylated proteins by liquid chromatography mass spectrometry. Proteomics. 2004 Feb;4(2):454-65. [14760718 ]
  12. Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res. 2009 Feb;8(2):651-61. doi: 10.1021/pr8008012. [19159218 ]
  13. Jia W, Lu Z, Fu Y, Wang HP, Wang LH, Chi H, Yuan ZF, Zheng ZB, Song LN, Han HH, Liang YM, Wang JL, Cai Y, Zhang YK, Deng YL, Ying WT, He SM, Qian XH: A strategy for precise and large scale identification of core fucosylated glycoproteins. Mol Cell Proteomics. 2009 May;8(5):913-23. doi: 10.1074/mcp.M800504-MCP200. Epub 2009 Jan 12. [19139490 ]
  14. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. [21269460 ]
  15. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. [24275569 ]

From www.t3db.ca