C-terminal-binding protein 1


NameC-terminal-binding protein 1
Synonyms
  • 1.1.1.-
  • CTBP
  • CtBP1
Gene NameCTBP1
OrganismHuman
Amino acid sequence
>lcl|BSEQ0005147|C-terminal-binding protein 1
MGSSHLLNKGLPLGVRPPIMNGPLHPRPLVALLDGRDCTVEMPILKDVATVAFCDAQSTQ
EIHEKVLNEAVGALMYHTITLTREDLEKFKALRIIVRIGSGFDNIDIKSAGDLGIAVCNV
PAASVEETADSTLCHILNLYRRATWLHQALREGTRVQSVEQIREVASGAARIRGETLGII
GLGRVGQAVALRAKAFGFNVLFYDPYLSDGVERALGLQRVSTLQDLLFHSDCVTLHCGLN
EHNHHLINDFTVKQMRQGAFLVNTARGGLVDEKALAQALKEGRIRGAALDVHESEPFSFS
QGPLKDAPNLICTPHAAWYSEQASIEMREEAAREIRRAITGRIPDSLKNCVNKDHLTAAT
HWASMDPAVVHPELNGAAYRYPPGVVGVAPTGIPAAVEGIVPSAMSLSHGLPPVAHPPHA
PSPGQTVKPEADRDHASDQL
Number of residuesNone
Molecular Weight47534.865
Theoretical pI6.76
GO Classification
Functions
  • oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
  • NAD binding
  • transcription factor activity, sequence-specific DNA binding
  • transcription factor binding
  • protein domain specific binding
  • RNA polymerase II transcription corepressor activity
  • protein homodimerization activity
  • NADH binding
  • repressing transcription factor binding
  • protein C-terminus binding
Processes
  • negative regulation of cell proliferation
  • positive regulation of histone deacetylation
  • protein phosphorylation
  • white fat cell differentiation
  • negative regulation of transcription from RNA polymerase II promoter
  • negative regulation of histone acetylation
  • transcription, DNA-templated
  • negative regulation of histone H4 acetylation
  • viral genome replication
  • negative regulation of transcription from RNA polymerase II promoter by histone modification
  • regulation of cell cycle
  • negative regulation of transcription, DNA-templated
Components
  • transcription factor complex
  • cytoplasm
  • nucleus
  • transcriptional repressor complex
  • nucleoplasm
General FunctionTranscription factor binding
Specific FunctionCorepressor targeting diverse transcription regulators such as GLIS2 or BCL6. Has dehydrogenase activity. Involved in controlling the equilibrium between tubular and stacked structures in the Golgi complex. Functions in brown adipose tissue (BAT) differentiation.
Transmembrane Regions
GenBank Protein ID
UniProtKB IDQ13363
UniProtKB Entry Name
Cellular LocationCytoplasm
Gene sequence
>lcl|BSEQ0019311|C-terminal-binding protein 1 (CTBP1)
ATGTCAGGCGTCCGACCTCCGATCATGAACGGGCCCCTGCACCCGCGGCCCCTGGTGGCA
TTGCTGGATGGCCGGGACTGCACAGTGGAGATGCCCATCCTGAAGGACGTGGCCACTGTG
GCCTTCTGCGACGCGCAGTCCACGCAGGAGATCCATGAGAAGGTCCTGAACGAGGCTGTG
GGGGCCCTGATGTACCACACCATCACTCTCACCAGGGAGGACCTGGAGAAGTTCAAAGCC
CTCCGCATCATCGTCCGGATTGGCAGTGGTTTTGACAACATCGACATCAAGTCGGCCGGG
GATTTAGGCATTGCCGTCTGCAACGTGCCCGCGGCGTCTGTGGAGGAGACGGCCGACTCG
ACGCTGTGCCACATCCTGAACCTGTACCGGCGGGCCACCTGGCTGCACCAGGCGCTGCGG
GAGGGCACACGAGTCCAGAGCGTCGAGCAGATCCGCGAGGTGGCGTCCGGCGCTGCCAGG
ATCCGCGGGGAGACCTTGGGCATCATCGGACTTGGTCGCGTGGGGCAGGCAGTGGCGCTG
CGGGCCAAGGCCTTCGGCTTCAACGTGCTCTTCTACGACCCTTACTTGTCGGATGGCGTG
GAGCGGGCGCTGGGGCTGCAGCGTGTCAGCACCCTGCAGGACCTGCTCTTCCACAGCGAC
TGCGTGACCCTGCACTGCGGCCTCAACGAGCACAACCACCACCTCATCAACGACTTCACC
GTCAAGCAGATGAGACAAGGGGCCTTCCTGGTGAACACAGCCCGGGGTGGCCTGGTGGAT
GAGAAGGCGCTGGCCCAGGCCCTGAAGGAGGGCCGGATCCGCGGCGCGGCCCTGGATGTG
CACGAGTCGGAACCCTTCAGCTTTAGCCAGGGCCCTCTGAAGGATGCACCCAACCTCATC
TGCACCCCCCATGCTGCATGGTACAGCGAGCAGGCATCCATCGAGATGCGAGAGGAGGCG
GCACGGGAGATCCGCAGAGCCATCACAGGCCGGATCCCAGACAGCCTGAAGAACTGTGTC
AACAAGGACCATCTGACAGCCGCCACCCACTGGGCCAGCATGGACCCCGCCGTCGTGCAC
CCTGAGCTCAATGGGGCTGCCTATAGGTACCCTCCGGGCGTGGTGGGCGTGGCCCCCACT
GGCATCCCAGCTGCTGTGGAAGGTATCGTCCCCAGCGCCATGTCCCTGTCCCACGGCCTG
CCCCCTGTGGCCCACCCGCCCCACGCCCCTTCTCCTGGCCAAACCGTCAAGCCCGAGGCG
GATAGAGACCACGCCAGTGACCAGTTGTAG
GenBank Gene ID
GeneCard IDNone
GenAtlas ID
HGNC ID
Chromosome Location4
Locus4p16
References
  1. Schaeper U, Boyd JM, Verma S, Uhlmann E, Subramanian T, Chinnadurai G: Molecular cloning and characterization of a cellular phosphoprotein that interacts with a conserved C-terminal domain of adenovirus E1A involved in negative modulation of oncogenic transformation. Proc Natl Acad Sci U S A. 1995 Nov 7;92(23):10467-71. [7479821 ]
  2. Sewalt RG, Gunster MJ, van der Vlag J, Satijn DP, Otte AP: C-Terminal binding protein is a transcriptional repressor that interacts with a specific class of vertebrate Polycomb proteins. Mol Cell Biol. 1999 Jan;19(1):777-87. [9858600 ]
  3. Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M, Becker MC, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Kremitzki C, Oddy L, Du H, Sun H, Bradshaw-Cordum H, Ali J, Carter J, Cordes M, Harris A, Isak A, van Brunt A, Nguyen C, Du F, Courtney L, Kalicki J, Ozersky P, Abbott S, Armstrong J, Belter EA, Caruso L, Cedroni M, Cotton M, Davidson T, Desai A, Elliott G, Erb T, Fronick C, Gaige T, Haakenson W, Haglund K, Holmes A, Harkins R, Kim K, Kruchowski SS, Strong CM, Grewal N, Goyea E, Hou S, Levy A, Martinka S, Mead K, McLellan MD, Meyer R, Randall-Maher J, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Shah N, Swearengen-Shahid S, Snider J, Strong JT, Thompson J, Yoakum M, Leonard S, Pearman C, Trani L, Radionenko M, Waligorski JE, Wang C, Rock SM, Tin-Wollam AM, Maupin R, Latreille P, Wendl MC, Yang SP, Pohl C, Wallis JW, Spieth J, Bieri TA, Berkowicz N, Nelson JO, Osborne J, Ding L, Meyer R, Sabo A, Shotland Y, Sinha P, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Jones TA, She X, Ciccarelli FD, Izaurralde E, Taylor J, Schmutz J, Myers RM, Cox DR, Huang X, McPherson JD, Mardis ER, Clifton SW, Warren WC, Chinwalla AT, Eddy SR, Marra MA, Ovcharenko I, Furey TS, Miller W, Eichler EE, Bork P, Suyama M, Torrents D, Waterston RH, Wilson RK: Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Nature. 2005 Apr 7;434(7034):724-31. [15815621 ]
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [15489334 ]
  5. Boyd JM, Subramanian T, Schaeper U, La Regina M, Bayley S, Chinnadurai G: A region in the C-terminus of adenovirus 2/5 E1a protein is required for association with a cellular phosphoprotein and important for the negative modulation of T24-ras mediated transformation, tumorigenesis and metastasis. EMBO J. 1993 Feb;12(2):469-78. [8440238 ]
  6. Chakraborty S, Senyuk V, Sitailo S, Chi Y, Nucifora G: Interaction of EVI1 with cAMP-responsive element-binding protein-binding protein (CBP) and p300/CBP-associated factor (P/CAF) results in reversible acetylation of EVI1 and in co-localization in nuclear speckles. J Biol Chem. 2001 Nov 30;276(48):44936-43. Epub 2001 Sep 21. [11568182 ]
  7. Touitou R, Hickabottom M, Parker G, Crook T, Allday MJ: Physical and functional interactions between the corepressor CtBP and the Epstein-Barr virus nuclear antigen EBNA3C. J Virol. 2001 Aug;75(16):7749-55. [11462050 ]
  8. Vo N, Fjeld C, Goodman RH: Acetylation of nuclear hormone receptor-interacting protein RIP140 regulates binding of the transcriptional corepressor CtBP. Mol Cell Biol. 2001 Sep;21(18):6181-8. [11509661 ]
  9. Hickabottom M, Parker GA, Freemont P, Crook T, Allday MJ: Two nonconsensus sites in the Epstein-Barr virus oncoprotein EBNA3A cooperate to bind the co-repressor carboxyl-terminal-binding protein (CtBP). J Biol Chem. 2002 Dec 6;277(49):47197-204. Epub 2002 Oct 7. [12372828 ]
  10. Kagey MH, Melhuish TA, Wotton D: The polycomb protein Pc2 is a SUMO E3. Cell. 2003 Apr 4;113(1):127-37. [12679040 ]
  11. Zhang Q, Yoshimatsu Y, Hildebrand J, Frisch SM, Goodman RH: Homeodomain interacting protein kinase 2 promotes apoptosis by downregulating the transcriptional corepressor CtBP. Cell. 2003 Oct 17;115(2):177-86. [14567915 ]
  12. Alpatov R, Munguba GC, Caton P, Joo JH, Shi Y, Shi Y, Hunt ME, Sugrue SP: Nuclear speckle-associated protein Pnn/DRS binds to the transcriptional corepressor CtBP and relieves CtBP-mediated repression of the E-cadherin gene. Mol Cell Biol. 2004 Dec;24(23):10223-35. [15542832 ]
  13. Castet A, Boulahtouf A, Versini G, Bonnet S, Augereau P, Vignon F, Khochbin S, Jalaguier S, Cavailles V: Multiple domains of the Receptor-Interacting Protein 140 contribute to transcription inhibition. Nucleic Acids Res. 2004 Apr 1;32(6):1957-66. Print 2004. [15060175 ]
  14. Long J, Zuo D, Park M: Pc2-mediated sumoylation of Smad-interacting protein 1 attenuates transcriptional repression of E-cadherin. J Biol Chem. 2005 Oct 21;280(42):35477-89. Epub 2005 Aug 1. [16061479 ]
  15. Nitta E, Izutsu K, Yamaguchi Y, Imai Y, Ogawa S, Chiba S, Kurokawa M, Hirai H: Oligomerization of Evi-1 regulated by the PR domain contributes to recruitment of corepressor CtBP. Oncogene. 2005 Sep 8;24(40):6165-73. [15897867 ]
  16. Schon C, Wochnik A, Rossner A, Donow C, Knochel W: The FoxP subclass in Xenopus laevis development. Dev Genes Evol. 2006 Oct;216(10):641-6. Epub 2006 Apr 12. [16609867 ]
  17. Ueda J, Tachibana M, Ikura T, Shinkai Y: Zinc finger protein Wiz links G9a/GLP histone methyltransferases to the co-repressor molecule CtBP. J Biol Chem. 2006 Jul 21;281(29):20120-8. Epub 2006 May 15. [16702210 ]
  18. Lopez-Garcia J, Periyasamy M, Thomas RS, Christian M, Leao M, Jat P, Kindle KB, Heery DM, Parker MG, Buluwela L, Kamalati T, Ali S: ZNF366 is an estrogen receptor corepressor that acts through CtBP and histone deacetylases. Nucleic Acids Res. 2006;34(21):6126-36. Epub 2006 Nov 3. [17085477 ]
  19. Matsuoka S, Ballif BA, Smogorzewska A, McDonald ER 3rd, Hurov KE, Luo J, Bakalarski CE, Zhao Z, Solimini N, Lerenthal Y, Shiloh Y, Gygi SP, Elledge SJ: ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage. Science. 2007 May 25;316(5828):1160-6. [17525332 ]
  20. Mendez LM, Polo JM, Yu JJ, Krupski M, Ding BB, Melnick A, Ye BH: CtBP is an essential corepressor for BCL6 autoregulation. Mol Cell Biol. 2008 Apr;28(7):2175-86. doi: 10.1128/MCB.01400-07. Epub 2008 Jan 22. [18212045 ]
  21. Purbey PK, Singh S, Notani D, Kumar PP, Limaye AS, Galande S: Acetylation-dependent interaction of SATB1 and CtBP1 mediates transcriptional repression by SATB1. Mol Cell Biol. 2009 Mar;29(5):1321-37. doi: 10.1128/MCB.00822-08. Epub 2008 Dec 22. [19103759 ]
  22. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. [21269460 ]
  23. Subramanian T, Zhao LJ, Chinnadurai G: Interaction of CtBP with adenovirus E1A suppresses immortalization of primary epithelial cells and enhances virus replication during productive infection. Virology. 2013 Sep 1;443(2):313-20. doi: 10.1016/j.virol.2013.05.018. Epub 2013 Jun 5. [23747199 ]
  24. Ichikawa K, Kubota Y, Nakamura T, Weng JS, Tomida T, Saito H, Takekawa M: MCRIP1, an ERK substrate, mediates ERK-induced gene silencing during epithelial-mesenchymal transition by regulating the co-repressor CtBP. Mol Cell. 2015 Apr 2;58(1):35-46. doi: 10.1016/j.molcel.2015.01.023. Epub 2015 Feb 26. [25728771 ]
  25. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. [24275569 ]
  26. Kumar V, Carlson JE, Ohgi KA, Edwards TA, Rose DW, Escalante CR, Rosenfeld MG, Aggarwal AK: Transcription corepressor CtBP is an NAD(+)-regulated dehydrogenase. Mol Cell. 2002 Oct;10(4):857-69. [12419229 ]

From www.t3db.ca