>lcl|BSEQ0011914|Flavodoxin
MPKALIVYGSTTGNTEYTAETIARELADAGYEVDSRDAASVEAGGLFEGFDLVLLGCSTW
GDDSIELQDDFIPLFDSLEETGAQGRKVACFGCGDSSYEYFCGAVDAIEEKLKNLGAEIV
QDGLRIDGDPRAARDDIVGWAHDVRGAI

>lcl|BSEQ0011915|Flavodoxin
ATGCCCAAAGCCCTCATCGTCTACGGTTCCACCACAGGCAACACGGAATACACCGCCGAA
ACCATCGCACGTGAACTTGCCGATGCAGGGTACGAAGTCGATAGCCGGGACGCGGCCTCT
GTCGAGGCTGGCGGTCTCTTCGAAGGCTTCGACCTCGTCCTTCTCGGATGCTCGACGTGG
GGTGACGACTCCATCGAACTGCAGGACGACTTCATTCCCCTTTTCGACTCCCTCGAAGAG
ACGGGGGCGCAGGGCCGCAAGGTGGCCTGCTTCGGCTGCGGCGACAGTTCCTACGAGTAC
TTCTGCGGGGCTGTCGACGCCATCGAAGAGAAGCTCAAGAACCTCGGTGCCGAAATCGTT
CAGGACGGTCTTCGCATCGATGGCGACCCCCGCGCCGCCCGGGACGACATCGTCGGCTGG
GCGCATGACGTGAGGGGCGCCATCTAG

1. Krey GD, Vanin EF, Swenson RP: Cloning, nucleotide sequence, and expression of the flavodoxin gene from Desulfovibrio vulgaris (Hildenborough). J Biol Chem. 1988 Oct 25;263(30):15436-43. [3170590 ]
2. Dubourdieu M, Fox JL: Amino acid sequence of Desulfovibrio vulgaris flavodoxin. J Biol Chem. 1977 Feb 25;252(4):1453-63. [402366 ]
3. Heidelberg JF, Seshadri R, Haveman SA, Hemme CL, Paulsen IT, Kolonay JF, Eisen JA, Ward N, Methe B, Brinkac LM, Daugherty SC, Deboy RT, Dodson RJ, Durkin AS, Madupu R, Nelson WC, Sullivan SA, Fouts D, Haft DH, Selengut J, Peterson JD, Davidsen TM, Zafar N, Zhou L, Radune D, Dimitrov G, Hance M, Tran K, Khouri H, Gill J, Utterback TR, Feldblyum TV, Wall JD, Voordouw G, Fraser CM: The genome sequence of the anaerobic, sulfate-reducing bacterium Desulfovibrio vulgaris Hildenborough. Nat Biotechnol. 2004 May;22(5):554-9. Epub 2004 Apr 11. [15077118 ]
4. Watt W, Tulinsky A, Swenson RP, Watenpaugh KD: Comparison of the crystal structures of a flavodoxin in its three oxidation states at cryogenic temperatures. J Mol Biol. 1991 Mar 5;218(1):195-208. [2002503 ]
5. Watenpaugh KD, Sieker LC, Jensen LH: The binding of riboflavin-5'-phosphate in a flavoprotein: flavodoxin at 2.0-Angstrom resolution. Proc Natl Acad Sci U S A. 1973 Dec;70(12):3857-60. [4521211 ]
6. Watenpaugh KD, Sieker LC, Jensen LH, Legall J, Dubourdieu M: Structure of the oxidized form of a flavodoxin at 2.5-Angstrom resolution: resolution of the phase ambiguity by anomalous scattering. Proc Natl Acad Sci U S A. 1972 Nov;69(11):3185-8. [4508313 ]
7. Walsh MA, McCarthy A, O'Farrell PA, McArdle P, Cunningham PD, Mayhew SG, Higgins TM: X-ray crystal structure of the Desulfovibrio vulgaris (Hildenborough) apoflavodoxin-riboflavin complex. Eur J Biochem. 1998 Dec 1;258(2):362-71. [9874201 ]
8. Knauf MA, Lohr F, Curley GP, O'Farrell P, Mayhew SG, Muller F, Ruterjans H: Homonuclear and heteronuclear NMR studies of oxidized Desulfovibrio vulgaris flavodoxin. Sequential assignments and identification of secondary structure elements. Eur J Biochem. 1993 Apr 1;213(1):167-84. [8477691 ]
9. Knauf MA, Lohr F, Blumel M, Mayhew SG, Ruterjans H: NMR investigation of the solution conformation of oxidized flavodoxin from Desulfovibrio vulgaris. Determination of the tertiary structure and detection of protein-bound water molecules. Eur J Biochem. 1996 Jun 1;238(2):423-34. [8681954 ]
10. Stockman BJ, Euvrard A, Kloosterman DA, Scahill TA, Swenson RP: 1H and 15N resonance assignments and solution secondary structure of oxidized Desulfovibrio vulgaris flavodoxin determined by heteronuclear three-dimensional NMR spectroscopy. J Biomol NMR. 1993 Mar;3(2):133-49. [8477184 ]