Galectin-1


NameGalectin-1
Synonyms
  • 14 kDa laminin-binding protein
  • 14 kDa lectin
  • Beta-galactoside-binding lectin L-14-I
  • Gal-1
  • Galaptin
  • HBL
  • HLBP14
  • HPL
  • Lactose-binding lectin 1
  • Lectin galactoside-binding soluble 1
  • Putative MAPK-activating protein PM12
  • S-Lac lectin 1
Gene NameLGALS1
OrganismHuman
Amino acid sequence
>lcl|BSEQ0019584|Galectin-1
MACGLVASNLNLKPGECLRVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIV
CNSKDGGAWGTEQREAVFPFQPGSVAEVCITFDQANLTVKLPDGYEFKFPNRLNLEAINY
MAADGDFKIKCVAFD
Number of residuesNone
Molecular Weight14715.57
Theoretical pINone
GO Classification
Functions
  • lactose binding
  • signal transducer activity
  • poly(A) RNA binding
Processes
  • apoptotic process
  • negative regulation of neuron projection development
  • response to axon injury
  • positive regulation of viral entry into host cell
  • T cell costimulation
  • plasma cell differentiation
  • signal transduction
  • positive regulation of erythrocyte aggregation
  • response to drug
  • myoblast differentiation
  • cellular response to organic cyclic compound
  • multicellular organismal response to stress
  • regulation of apoptotic process
  • positive regulation of I-kappaB kinase/NF-kappaB signaling
  • cellular response to glucose stimulus
  • negative regulation of cell-substrate adhesion
Components
  • intracellular
  • cytoplasm
  • nucleus
  • proteinaceous extracellular matrix
  • extracellular space
  • cell surface
  • extracellular exosome
General FunctionSignal transducer activity
Specific FunctionLectin that binds beta-galactoside and a wide array of complex carbohydrates. Plays a role in regulating apoptosis, cell proliferation and cell differentiation. Inhibits CD45 protein phosphatase activity and therefore the dephosphorylation of Lyn kinase. Strong inducer of T-cell apoptosis.
Transmembrane Regions
GenBank Protein ID
UniProtKB IDP09382
UniProtKB Entry Name
Cellular LocationSecreted
Gene sequence
>lcl|BSEQ0019585|Galectin-1 (LGALS1)
ATGGCTTGTGGTCTGGTCGCCAGCAACCTGAATCTCAAACCTGGAGAGTGCCTTCGAGTG
CGAGGCGAGGTGGCTCCTGACGCTAAGAGCTTCGTGCTGAACCTGGGCAAAGACAGCAAC
AACCTGTGCCTGCACTTCAACCCTCGCTTCAACGCCCACGGCGACGCCAACACCATCGTG
TGCAACAGCAAGGACGGCGGGGCCTGGGGGACCGAGCAGCGGGAGGCTGTCTTTCCCTTC
CAGCCTGGAAGTGTTGCAGAGGTGTGCATCACCTTCGACCAGGCCAACCTGACCGTCAAG
CTGCCAGATGGATACGAATTCAAGTTCCCCAACCGCCTCAACCTGGAGGCCATCAACTAC
ATGGCAGCTGACGGTGACTTCAAGATCAAATGTGTGGCCTTTGACTGA
GenBank Gene ID
GeneCard IDNone
GenAtlas ID
HGNC ID
Chromosome Location22
LocusNone
References
  1. Hirabayashi J, Ayaki H, Soma G, Kasai K: Cloning and nucleotide sequence of a full-length cDNA for human 14 kDa beta-galactoside-binding lectin. Biochim Biophys Acta. 1989 Jun 1;1008(1):85-91. [2719964 ]
  2. Couraud PO, Casentini-Borocz D, Bringman TS, Griffith J, McGrogan M, Nedwin GE: Molecular cloning, characterization, and expression of a human 14-kDa lectin. J Biol Chem. 1989 Jan 15;264(2):1310-6. [2910856 ]
  3. Abbott WM, Feizi T: Evidence that the 14 kDa soluble beta-galactoside-binding lectin in man is encoded by a single gene. Biochem J. 1989 Apr 1;259(1):291-4. [2719646 ]
  4. Than NG, Romero R, Erez O, Weckle A, Tarca AL, Hotra J, Abbas A, Han YM, Kim SS, Kusanovic JP, Gotsch F, Hou Z, Santolaya-Forgas J, Benirschke K, Papp Z, Grossman LI, Goodman M, Wildman DE: Emergence of hormonal and redox regulation of galectin-1 in placental mammals: implication in maternal-fetal immune tolerance. Proc Natl Acad Sci U S A. 2008 Oct 14;105(41):15819-24. doi: 10.1073/pnas.0807606105. Epub 2008 Sep 29. [18824694 ]
  5. Gitt MA, Barondes SH: Genomic sequence and organization of two members of a human lectin gene family. Biochemistry. 1991 Jan 8;30(1):82-9. [1988031 ]
  6. Matsuda A, Suzuki Y, Honda G, Muramatsu S, Matsuzaki O, Nagano Y, Doi T, Shimotohno K, Harada T, Nishida E, Hayashi H, Sugano S: Large-scale identification and characterization of human genes that activate NF-kappaB and MAPK signaling pathways. Oncogene. 2003 May 22;22(21):3307-18. [12761501 ]
  7. Collins JE, Wright CL, Edwards CA, Davis MP, Grinham JA, Cole CG, Goward ME, Aguado B, Mallya M, Mokrab Y, Huckle EJ, Beare DM, Dunham I: A genome annotation-driven approach to cloning the human ORFeome. Genome Biol. 2004;5(10):R84. Epub 2004 Sep 30. [15461802 ]
  8. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [14702039 ]
  9. Dunham I, Shimizu N, Roe BA, Chissoe S, Hunt AR, Collins JE, Bruskiewich R, Beare DM, Clamp M, Smink LJ, Ainscough R, Almeida JP, Babbage A, Bagguley C, Bailey J, Barlow K, Bates KN, Beasley O, Bird CP, Blakey S, Bridgeman AM, Buck D, Burgess J, Burrill WD, O'Brien KP, et al.: The DNA sequence of human chromosome 22. Nature. 1999 Dec 2;402(6761):489-95. [10591208 ]
  10. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [15489334 ]
  11. Hirabayashi J, Kasai K: Complete amino acid sequence of a beta-galactoside-binding lectin from human placenta. J Biochem. 1988 Jul;104(1):1-4. [3065332 ]
  12. Gevaert K, Goethals M, Martens L, Van Damme J, Staes A, Thomas GR, Vandekerckhove J: Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides. Nat Biotechnol. 2003 May;21(5):566-9. Epub 2003 Mar 31. [12665801 ]
  13. Hirabayashi J, Kawasaki H, Suzuki K, Kasai K: Further characterization and structural studies on human placenta lectin. J Biochem. 1987 Apr;101(4):987-95. [3611046 ]
  14. Castronovo V, Luyten F, van den Brule F, Sobel ME: Identification of a 14-kDa laminin binding protein (HLBP14) in human melanoma cells that is identical to the 14-kDa galactoside binding lectin. Arch Biochem Biophys. 1992 Aug 15;297(1):132-8. [1386213 ]
  15. Sharma A, Chemelli R, Allen HJ: Human splenic galaptin: physicochemical characterization. Biochemistry. 1990 Jun 5;29(22):5309-14. [2383549 ]
  16. Perillo NL, Pace KE, Seilhamer JJ, Baum LG: Apoptosis of T cells mediated by galectin-1. Nature. 1995 Dec 14;378(6558):736-9. [7501023 ]
  17. Walzel H, Schulz U, Neels P, Brock J: Galectin-1, a natural ligand for the receptor-type protein tyrosine phosphatase CD45. Immunol Lett. 1999 Apr 15;67(3):193-202. [10369126 ]
  18. Fouillit M, Joubert-Caron R, Poirier F, Bourin P, Monostori E, Levi-Strauss M, Raphael M, Bladier D, Caron M: Regulation of CD45-induced signaling by galectin-1 in Burkitt lymphoma B cells. Glycobiology. 2000 Apr;10(4):413-9. [10764829 ]
  19. Tinari N, Kuwabara I, Huflejt ME, Shen PF, Iacobelli S, Liu FT: Glycoprotein 90K/MAC-2BP interacts with galectin-1 and mediates galectin-1-induced cell aggregation. Int J Cancer. 2001 Jan 15;91(2):167-72. [11146440 ]
  20. He J, Baum LG: Presentation of galectin-1 by extracellular matrix triggers T cell death. J Biol Chem. 2004 Feb 6;279(6):4705-12. Epub 2003 Nov 14. [14617626 ]
  21. Than NG, Romero R, Goodman M, Weckle A, Xing J, Dong Z, Xu Y, Tarquini F, Szilagyi A, Gal P, Hou Z, Tarca AL, Kim CJ, Kim JS, Haidarian S, Uddin M, Bohn H, Benirschke K, Santolaya-Forgas J, Grossman LI, Erez O, Hassan SS, Zavodszky P, Papp Z, Wildman DE: A primate subfamily of galectins expressed at the maternal-fetal interface that promote immune cell death. Proc Natl Acad Sci U S A. 2009 Jun 16;106(24):9731-6. doi: 10.1073/pnas.0903568106. Epub 2009 Jun 2. [19497882 ]
  22. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [19608861 ]
  23. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. [21269460 ]
  24. Rosenow A, Noben JP, Jocken J, Kallendrusch S, Fischer-Posovszky P, Mariman EC, Renes J: Resveratrol-induced changes of the human adipocyte secretion profile. J Proteome Res. 2012 Sep 7;11(9):4733-43. doi: 10.1021/pr300539b. Epub 2012 Aug 27. [22905912 ]
  25. Bienvenut WV, Sumpton D, Martinez A, Lilla S, Espagne C, Meinnel T, Giglione C: Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-alpha-acetylation features. Mol Cell Proteomics. 2012 Jun;11(6):M111.015131. doi: 10.1074/mcp.M111.015131. Epub 2012 Jan 5. [22223895 ]
  26. Van Damme P, Lasa M, Polevoda B, Gazquez C, Elosegui-Artola A, Kim DS, De Juan-Pardo E, Demeyer K, Hole K, Larrea E, Timmerman E, Prieto J, Arnesen T, Sherman F, Gevaert K, Aldabe R: N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB. Proc Natl Acad Sci U S A. 2012 Jul 31;109(31):12449-54. doi: 10.1073/pnas.1210303109. Epub 2012 Jul 18. [22814378 ]
  27. Watson AP, Evans RL, Egland KA: Multiple functions of sushi domain containing 2 (SUSD2) in breast tumorigenesis. Mol Cancer Res. 2013 Jan;11(1):74-85. doi: 10.1158/1541-7786.MCR-12-0501-T. Epub 2012 Nov 6. [23131994 ]
  28. Escoda-Ferran C, Carrasco E, Caballero-Banos M, Miro-Julia C, Martinez-Florensa M, Consuegra-Fernandez M, Martinez VG, Liu FT, Lozano F: Modulation of CD6 function through interaction with Galectin-1 and -3. FEBS Lett. 2014 Aug 25;588(17):2805-13. doi: 10.1016/j.febslet.2014.05.064. Epub 2014 Jun 16. [24945728 ]
  29. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. [24275569 ]
  30. Tagliabracci VS, Wiley SE, Guo X, Kinch LN, Durrant E, Wen J, Xiao J, Cui J, Nguyen KB, Engel JL, Coon JJ, Grishin N, Pinna LA, Pagliarini DJ, Dixon JE: A Single Kinase Generates the Majority of the Secreted Phosphoproteome. Cell. 2015 Jun 18;161(7):1619-32. doi: 10.1016/j.cell.2015.05.028. [26091039 ]
  31. Vaca Jacome AS, Rabilloud T, Schaeffer-Reiss C, Rompais M, Ayoub D, Lane L, Bairoch A, Van Dorsselaer A, Carapito C: N-terminome analysis of the human mitochondrial proteome. Proteomics. 2015 Jul;15(14):2519-24. doi: 10.1002/pmic.201400617. Epub 2015 Jun 8. [25944712 ]
  32. Lopez-Lucendo MF, Solis D, Andre S, Hirabayashi J, Kasai K, Kaltner H, Gabius HJ, Romero A: Growth-regulatory human galectin-1: crystallographic characterisation of the structural changes induced by single-site mutations and their impact on the thermodynamics of ligand binding. J Mol Biol. 2004 Oct 29;343(4):957-70. [15476813 ]
  33. Nishi N, Abe A, Iwaki J, Yoshida H, Itoh A, Shoji H, Kamitori S, Hirabayashi J, Nakamura T: Functional and structural bases of a cysteine-less mutant as a long-lasting substitute for galectin-1. Glycobiology. 2008 Dec;18(12):1065-73. doi: 10.1093/glycob/cwn089. Epub 2008 Sep 16. [18796645 ]
  34. Di Lella S, Ma L, Ricci JC, Rabinovich GA, Asher SA, Alvarez RM: Critical role of the solvent environment in galectin-1 binding to the disaccharide lactose. Biochemistry. 2009 Feb 3;48(4):786-91. doi: 10.1021/bi801855g. [19128029 ]

From www.t3db.ca