Tautomerase PptA

NameTautomerase PptA
Synonyms
  • 5.3.2.-
  • ydcE
Gene NamepptA
OrganismEscherichia coli (strain K12)
Amino acid sequence
>lcl|BSEQ0011161|Tautomerase PptA
MPHIDIKCFPRELDEQQKAALAADITDVIIRHLNSKDSSISIALQQIQPESWQAIWDAEI
APQMEALIKKPGYSMNA
Number of residuesNone
Molecular Weight8672.84
Theoretical pI4.66
GO Classification
Functions
  • intramolecular oxidoreductase activity, interconverting keto- and enol-groups
Processes
  • cellular aromatic compound metabolic process
Components
  • cytoplasm
General FunctionIntramolecular oxidoreductase activity, interconverting keto- and enol-groups
Specific FunctionCan use enol isomers of phenylpyruvate, 2-hydroxy-2,4-pentadienoate and (p-hydroxyphenyl)pyruvate as substrates.
Transmembrane Regions
GenBank Protein ID
UniProtKB IDP31992
UniProtKB Entry Name
Cellular LocationCytoplasm
Gene sequence
>lcl|BSEQ0011162|Tautomerase PptA (pptA)
ATGCCGCACATCGACATTAAATGTTTTCCGCGTGAACTGGACGAACAACAAAAAGCAGCA
CTTGCTGCAGATATTACCGACGTTATTATTCGTCATCTGAACAGTAAAGACAGTTCGATA
AGCATTGCTCTACAGCAGATTCAACCAGAATCTTGGCAAGCTATCTGGGATGCCGAAATC
GCGCCCCAAATGGAGGCTTTGATAAAGAAACCTGGTTATAGCATGAATGCTTAA
GenBank Gene ID
GeneCard IDNone
GenAtlas ID
HGNC ID
Chromosome LocationNone
LocusNone
References
  1. Zhao S, Sandt CH, Feulner G, Vlazny DA, Gray JA, Hill CW: Rhs elements of Escherichia coli K-12: complex composites of shared and unique components that have different evolutionary histories. J Bacteriol. 1993 May;175(10):2799-808. [8387990 ]
  2. Aiba H, Baba T, Hayashi K, Inada T, Isono K, Itoh T, Kasai H, Kashimoto K, Kimura S, Kitakawa M, Kitagawa M, Makino K, Miki T, Mizobuchi K, Mori H, Mori T, Motomura K, Nakade S, Nakamura Y, Nashimoto H, Nishio Y, Oshima T, Saito N, Sampei G, Horiuchi T, et al.: A 570-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 28.0-40.1 min region on the linkage map. DNA Res. 1996 Dec 31;3(6):363-77. [9097039 ]
  3. Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y: The complete genome sequence of Escherichia coli K-12. Science. 1997 Sep 5;277(5331):1453-62. [9278503 ]
  4. Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T: Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Mol Syst Biol. 2006;2:2006.0007. Epub 2006 Feb 21. [16738553 ]
  5. Almrud JJ, Kern AD, Wang SC, Czerwinski RM, Johnson WH Jr, Murzin AG, Hackert ML, Whitman CP: The crystal structure of YdcE, a 4-oxalocrotonate tautomerase homologue from Escherichia coli, confirms the structural basis for oligomer diversity. Biochemistry. 2002 Oct 8;41(40):12010-24. [12356301 ]

From www.t3db.ca