Heat-labile enterotoxin B chain

NameHeat-labile enterotoxin B chain
Synonyms
  • LT-B, porcine
  • LTP-B
  • ltpB
Gene NameeltB
OrganismEscherichia coli
Amino acid sequence
>lcl|BSEQ0011042|Heat-labile enterotoxin B chain
MNKVKCYVLFTALLSSLYAHGAPQTITELCSEYRNTQIYTINDKILSYTESMAGKREMVI
ITFKSGETFQVEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAI
SMKN
Number of residuesNone
Molecular Weight14133.255
Theoretical pI9.12
GO Classification
Functions
Processes
  • pathogenesis
  • killing of cells of other organism
Components
  • extracellular region
General FunctionNone
Specific FunctionThe biological activity of the toxin is produced by the A chain, which activates intracellular adenyl cyclase.
Transmembrane Regions
GenBank Protein ID
UniProtKB IDP32890
UniProtKB Entry Name
Cellular LocationNone
Gene sequence
>lcl|BSEQ0002931|375 bp
ATGAATAAAGTAAAATGTTATGTTTTATTTACGGCGTTACTATCCTCTCTATATGCACAC
GGAGCTCCCCAGACTATTACAGAACTATGTTCGGAATATCGCAACACACAAATATATACG
ATAAATGACAAGATACTATCATATACGGAATCGATGGCAGGCAAAAGAGAAATGGTTATC
ATTACATTTAAGAGCGGCGAAACATTTCAGGTCGAAGTCCCGGGCAGTCAACATATAGAC
TCCCAGAAAAAAGCCATTGAAAGGATGAAGGACACATTAAGAATCACATATCTGACCGAG
ACCAAAATTGATAAATTATGTGTATGGAATAATAAAACCCCCAATTCAATTGCGGCAATC
AGTATGAAAAACTAG
GenBank Gene ID
GeneCard IDNone
GenAtlas ID
HGNC ID
Chromosome LocationNone
LocusNone
References
  1. Dallas WS, Falkow S: Amino acid sequence homology between cholera toxin and Escherichia coli heat-labile toxin. Nature. 1980 Dec 4;288(5790):499-501. [7003397 ]
  2. Leong J, Vinal AC, Dallas WS: Nucleotide sequence comparison between heat-labile toxin B-subunit cistrons from Escherichia coli of human and porcine origin. Infect Immun. 1985 Apr;48(1):73-7. [3884513 ]
  3. Yamamoto T, Gojobori T, Yokota T: Evolutionary origin of pathogenic determinants in enterotoxigenic Escherichia coli and Vibrio cholerae O1. J Bacteriol. 1987 Mar;169(3):1352-7. [3546273 ]
  4. Ibrahimi I, Gentz R: A functional interaction between the signal peptide and the translation apparatus is detected by the use of a single point mutation which blocks translocation across mammalian endoplasmic reticulum. J Biol Chem. 1987 Jul 25;262(21):10189-94. [3301830 ]
  5. Tsuji T, Iida T, Honda T, Miwatani T, Nagahama M, Sakurai J, Wada K, Matsubara H: A unique amino acid sequence of the B subunit of a heat-labile enterotoxin isolated from a human enterotoxigenic Escherichia coli. Microb Pathog. 1987 May;2(5):381-90. [3333803 ]
  6. Sixma TK, Kalk KH, van Zanten BA, Dauter Z, Kingma J, Witholt B, Hol WG: Refined structure of Escherichia coli heat-labile enterotoxin, a close relative of cholera toxin. J Mol Biol. 1993 Apr 5;230(3):890-918. [8478941 ]
  7. Sixma TK, Pronk SE, Kalk KH, Wartna ES, van Zanten BA, Witholt B, Hol WG: Crystal structure of a cholera toxin-related heat-labile enterotoxin from E. coli. Nature. 1991 May 30;351(6325):371-7. [2034287 ]
  8. Pickens JC, Merritt EA, Ahn M, Verlinde CL, Hol WG, Fan E: Anchor-based design of improved cholera toxin and E. coli heat-labile enterotoxin receptor binding antagonists that display multiple binding modes. Chem Biol. 2002 Feb;9(2):215-24. [11880036 ]
  9. Domenighini M, Pizza M, Jobling MG, Holmes RK, Rappuoli R: Identification of errors among database sequence entries and comparison of correct amino acid sequences for the heat-labile enterotoxins of Escherichia coli and Vibrio cholerae. Mol Microbiol. 1995 Mar;15(6):1165-7. [7623669 ]

From www.t3db.ca