3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ

Name3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ
Synonyms
  • (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
  • 4.2.1.59
  • Beta-hydroxyacyl-ACP dehydratase
Gene NamefabZ
OrganismHelicobacter pylori
Amino acid sequence
>lcl|BSEQ0022083|3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ
MEQSHQNLQSQFFIEHILQILPHRYPMLLVDRITELQANQKIVAYKNITFNEDVFNGHFP
NKPIFPGVLIVEGMAQSGGFLAFTSLWGFDPEIAKTKIVYFMTIDKVKFRIPVTPGDRLE
YHLEVLKHKGMIWQVGGTAQVDGKVVAEAELKAMIAERE
Number of residuesNone
Molecular Weight18184.08
Theoretical pI6.81
GO Classification
Functions
  • 3-hydroxyoctanoyl-[acyl-carrier-protein] dehydratase activity
Processes
  • fatty acid biosynthetic process
  • lipid A biosynthetic process
Components
  • cytoplasm
General Function3-hydroxyoctanoyl-[acyl-carrier-protein] dehydratase activity
Specific FunctionInvolved in unsaturated fatty acids biosynthesis. Catalyzes the dehydration of short chain beta-hydroxyacyl-ACPs and long chain saturated and unsaturated beta-hydroxyacyl-ACPs.Involved in unsaturated fatty acids biosynthesis. Catalyzes the dehydration of short chain beta-hydroxyacyl-ACPs and long chain saturated and unsaturated beta-hydroxyacyl-ACPs (By similarity).
Transmembrane Regions
GenBank Protein ID
UniProtKB IDQ5G940
UniProtKB Entry Name
Cellular LocationCytoplasm
Gene sequence
None
GenBank Gene ID
GeneCard IDNone
GenAtlas ID
HGNC ID
Chromosome LocationNone
LocusNone
References
  1. Liu W, Luo C, Han C, Peng S, Yang Y, Yue J, Shen X, Jiang H: A new beta-hydroxyacyl-acyl carrier protein dehydratase (FabZ) from Helicobacter pylori: Molecular cloning, enzymatic characterization, and structural modeling. Biochem Biophys Res Commun. 2005 Aug 12;333(4):1078-86. [15967411 ]
  2. Kong YH, Zhang L, Yang ZY, Han C, Hu LH, Jiang HL, Shen X: Natural product juglone targets three key enzymes from Helicobacter pylori: inhibition assay with crystal structure characterization. Acta Pharmacol Sin. 2008 Jul;29(7):870-6. doi: 10.1111/j.1745-7254.2008.00808.x. [18565285 ]
  3. Zhang L, Kong Y, Wu D, Zhang H, Wu J, Chen J, Ding J, Hu L, Jiang H, Shen X: Three flavonoids targeting the beta-hydroxyacyl-acyl carrier protein dehydratase from Helicobacter pylori: crystal structure characterization with enzymatic inhibition assay. Protein Sci. 2008 Nov;17(11):1971-8. doi: 10.1110/ps.036186.108. Epub 2008 Sep 9. [18780820 ]
  4. Chen J, Zhang L, Zhang Y, Zhang H, Du J, Ding J, Guo Y, Jiang H, Shen X: Emodin targets the beta-hydroxyacyl-acyl carrier protein dehydratase from Helicobacter pylori: enzymatic inhibition assay with crystal structural and thermodynamic characterization. BMC Microbiol. 2009 May 12;9:91. doi: 10.1186/1471-2180-9-91. [19433000 ]
  5. He L, Zhang L, Liu X, Li X, Zheng M, Li H, Yu K, Chen K, Shen X, Jiang H, Liu H: Discovering potent inhibitors against the beta-hydroxyacyl-acyl carrier protein dehydratase (FabZ) of Helicobacter pylori: structure-based design, synthesis, bioassay, and crystal structure determination. J Med Chem. 2009 Apr 23;52(8):2465-81. doi: 10.1021/jm8015602. [19309082 ]

From www.t3db.ca