Ig epsilon chain C region

Name	Ig epsilon chain C region
Synonyms
Gene Name	IGHE
Organism	Human
Amino acid sequence	>lcl\|BSEQ0005613\|Ig epsilon chain C region ASTQSPSVFPLTRCCKNIPSNATSVTLGCLATGYFPEPVMVTWDTGSLNGTTMTLPATTL TLSGHYATISLLTVSGAWAKQMFTCRVAHTPSSTDWVDNKTFSVCSRDFTPPTVKILQSS CDGGGHFPPTIQLLCLVSGYTPGTINITWLEDGQVMDVDLSTASTTQEGELASTQSELTL SQKHWLSDRTYTCQVTYQGHTFEDSTKKCADSNPRGVSAYLSRPSPFDLFIRKSPTITCL VVDLAPSKGTVNLTWSRASGKPVNHSTRKEEKQRNGTLTVTSTLPVGTRDWIEGETYQCR VTHPHLPRALMRSTTKTSGPRAAPEVYAFATPEWPGSRDKRTLACLIQNFMPEDISVQWL HNEVQLPDARHSTTQPRKTKGSGFFVFSRLEVTRAEWEQKDEFICRAVHEAASPSQTVQR AVSVNPGK
Number of residues	428
Molecular Weight	47018.665
Theoretical pI	8.13
GO Classification	Functions antigen binding immunoglobulin receptor binding Processes defense response to bacterium phagocytosis, engulfment B cell receptor signaling pathway complement activation, classical pathway immune response Fc-gamma receptor signaling pathway involved in phagocytosis innate immune response phagocytosis, recognition Fc-epsilon receptor signaling pathway positive regulation of B cell activation receptor-mediated endocytosis Components blood microparticle extracellular region immunoglobulin complex, circulating external side of plasma membrane
General Function	Immunoglobulin receptor binding
Specific Function	None
Transmembrane Regions
GenBank Protein ID
UniProtKB ID	P01854
UniProtKB Entry Name	IGHE_HUMAN
Cellular Location
Gene sequence	None
GenBank Gene ID
GeneCard ID	None
GenAtlas ID	IGHE
HGNC ID	HGNC:5522
Chromosome Location	None
Locus	14q32.33
References	Max EE, Battey J, Ney R, Kirsch IR, Leder P: Duplication and deletion in the human immunoglobulin epsilon genes. Cell. 1982 Jun;29(2):691-9.[6288268 ] Flanagan JG, Rabbitts TH: The sequence of a human immunoglobulin epsilon heavy chain constant region gene, and evidence for three non-allelic genes. EMBO J. 1982;1(5):655-60.[6234164 ] Ueda S, Nakai S, Nishida Y, Hisajima H, Honjo T: Long terminal repeat-like elements flank a human immunoglobulin epsilon pseudogene that lacks introns. EMBO J. 1982;1(12):1539-44.[6327276 ] Seno M, Kurokawa T, Ono Y, Onda H, Sasada R, Igarashi K, Kikuchi M, Sugino Y, Nishida Y, Honjo T: Molecular cloning and nucleotide sequencing of human immunoglobulin epsilon chain cDNA. Nucleic Acids Res. 1983 Feb 11;11(3):719-26.[6300763 ] Heilig R, Eckenberg R, Petit JL, Fonknechten N, Da Silva C, Cattolico L, Levy M, Barbe V, de Berardinis V, Ureta-Vidal A, Pelletier E, Vico V, Anthouard V, Rowen L, Madan A, Qin S, Sun H, Du H, Pepin K, Artiguenave F, Robert C, Cruaud C, Bruls T, Jaillon O, Friedlander L, Samson G, Brottier P, Cure S, Segurens B, Aniere F, Samain S, Crespeau H, Abbasi N, Aiach N, Boscus D, Dickhoff R, Dors M, Dubois I, Friedman C, Gouyvenoux M, James R, Madan A, Mairey-Estrada B, Mangenot S, Martins N, Menard M, Oztas S, Ratcliffe A, Shaffer T, Trask B, Vacherie B, Bellemere C, Belser C, Besnard-Gonnet M, Bartol-Mavel D, Boutard M, Briez-Silla S, Combette S, Dufosse-Laurent V, Ferron C, Lechaplais C, Louesse C, Muselet D, Magdelenat G, Pateau E, Petit E, Sirvain-Trukniewicz P, Trybou A, Vega-Czarny N, Bataille E, Bluet E, Bordelais I, Dubois M, Dumont C, Guerin T, Haffray S, Hammadi R, Muanga J, Pellouin V, Robert D, Wunderle E, Gauguet G, Roy A, Sainte-Marthe L, Verdier J, Verdier-Discala C, Hillier L, Fulton L, McPherson J, Matsuda F, Wilson R, Scarpelli C, Gyapay G, Wincker P, Saurin W, Quetier F, Waterston R, Hood L, Weissenbach J: The DNA sequence and analysis of human chromosome 14. Nature. 2003 Feb 6;421(6923):601-7. Epub 2003 Jan 1.[12508121 ] Kenten JH, Molgaard HV, Houghton M, Derbyshire RB, Viney J, Bell LO, Gould HJ: Cloning and sequence determination of the gene for the human immunoglobulin epsilon chain expressed in a myeloma cell line. Proc Natl Acad Sci U S A. 1982 Nov;79(21):6661-5.[6815656 ] Padlan EA, Davies DR: A model of the Fc of immunoglobulin E. Mol Immunol. 1986 Oct;23(10):1063-75.[3796618 ]

From www.t3db.ca