• Protein M8

>lcl|BSEQ0017656|Putative testis-specific prion protein
MQHSLVFFFAVILHLSHLLHLDASIHPFRLPFSSKPFLLIPMSNTTLPHTAWPLSFLHQT
VSTLKAVAVTHSLWHLQIPVDCQACNRKSKKIYC

None

1. Makrinou E, Collinge J, Antoniou M: Genomic characterization of the human prion protein (PrP) gene locus. Mamm Genome. 2002 Dec;13(12):696-703.[12514748 ]
2. Deloukas P, Matthews LH, Ashurst J, Burton J, Gilbert JG, Jones M, Stavrides G, Almeida JP, Babbage AK, Bagguley CL, Bailey J, Barlow KF, Bates KN, Beard LM, Beare DM, Beasley OP, Bird CP, Blakey SE, Bridgeman AM, Brown AJ, Buck D, Burrill W, Butler AP, Carder C, Carter NP, Chapman JC, Clamp M, Clark G, Clark LN, Clark SY, Clee CM, Clegg S, Cobley VE, Collier RE, Connor R, Corby NR, Coulson A, Coville GJ, Deadman R, Dhami P, Dunn M, Ellington AG, Frankland JA, Fraser A, French L, Garner P, Grafham DV, Griffiths C, Griffiths MN, Gwilliam R, Hall RE, Hammond S, Harley JL, Heath PD, Ho S, Holden JL, Howden PJ, Huckle E, Hunt AR, Hunt SE, Jekosch K, Johnson CM, Johnson D, Kay MP, Kimberley AM, King A, Knights A, Laird GK, Lawlor S, Lehvaslaiho MH, Leversha M, Lloyd C, Lloyd DM, Lovell JD, Marsh VL, Martin SL, McConnachie LJ, McLay K, McMurray AA, Milne S, Mistry D, Moore MJ, Mullikin JC, Nickerson T, Oliver K, Parker A, Patel R, Pearce TA, Peck AI, Phillimore BJ, Prathalingam SR, Plumb RW, Ramsay H, Rice CM, Ross MT, Scott CE, Sehra HK, Shownkeen R, Sims S, Skuce CD, Smith ML, Soderlund C, Steward CA, Sulston JE, Swann M, Sycamore N, Taylor R, Tee L, Thomas DW, Thorpe A, Tracey A, Tromans AC, Vaudin M, Wall M, Wallis JM, Whitehead SL, Whittaker P, Willey DL, Williams L, Williams SA, Wilming L, Wray PW, Hubbard T, Durbin RM, Bentley DR, Beck S, Rogers J: The DNA sequence and comparative analysis of human chromosome 20. Nature. 2001 Dec 20-27;414(6866):865-71.[11780052 ]
3. Choi SH, Kim IC, Kim DS, Kim DW, Chae SH, Choi HH, Choi I, Yeo JS, Song MN, Park HS: Comparative genomic organization of the human and bovine PRNP locus. Genomics. 2006 May;87(5):598-607. Epub 2006 Feb 7.[16460908 ]
4. Watts JC, Westaway D: The prion protein family: diversity, rivalry, and dysfunction. Biochim Biophys Acta. 2007 Jun;1772(6):654-72.[17562432 ]
5. Premzl M, Gamulin V: Comparative genomic analysis of prion genes. BMC Genomics. 2007 Jan 2;8:1.[17199895 ]