Insulin-like growth factor-binding protein 5

Name	Insulin-like growth factor-binding protein 5
Synonyms	IBP-5 IBP5
Gene Name	IGFBP5
Organism	Human
Amino acid sequence	>lcl\|BSEQ0013805\|Insulin-like growth factor-binding protein 5 MVLLTAVLLLLAAYAGPAQSLGSFVHCEPCDEKALSMCPPSPLGCELVKEPGCGCCMTCA LAEGQSCGVYTERCAQGLRCLPRQDEEKPLHALLHGRGVCLNEKSYREQVKIERDSREHE EPTTSEMAEETYSPKIFRPKHTRISELKAEAVKKDRRKKLTQSKFVGGAENTAHPRIISA PEMRQESEQGPCRRHMEASLQELKASPRMVPRAVYLPNCDRKGFYKRKQCKPSRGRKRGI CWCVDKYGMKLPGMEYVDGDFQCHTFDSSNVE
Number of residues	272
Molecular Weight	30569.985
Theoretical pI	None
GO Classification	Functions fibronectin binding insulin-like growth factor I binding insulin-like growth factor II binding Processes negative regulation of translation negative regulation of muscle tissue development cellular response to cAMP regulation of cell growth negative regulation of skeletal muscle hypertrophy positive regulation of protein kinase B signaling glucose homeostasis regulation of glucose metabolic process glucose metabolic process negative regulation of smooth muscle cell proliferation positive regulation of insulin-like growth factor receptor signaling pathway osteoblast differentiation lung alveolus development type B pancreatic cell proliferation cellular protein metabolic process cellular response to organic cyclic compound negative regulation of osteoblast differentiation intracellular signal transduction hair follicle morphogenesis striated muscle cell differentiation female pregnancy negative regulation of growth skeletal muscle tissue growth negative regulation of cell migration response to growth hormone signal transduction negative regulation of smooth muscle cell migration negative regulation of insulin-like growth factor receptor signaling pathway mammary gland involution Components extracellular space insulin-like growth factor binding protein complex insulin-like growth factor ternary complex intracellular extracellular region
General Function	Insulin-like growth factor ii binding
Specific Function	IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors.
Transmembrane Regions
GenBank Protein ID
UniProtKB ID	P24593
UniProtKB Entry Name	IBP5_HUMAN
Cellular Location	Secreted
Gene sequence	>lcl\|BSEQ0013806\|Insulin-like growth factor-binding protein 5 (IGFBP5) ATGGTGTTGCTCACCGCGGTCCTCCTGCTGCTGGCCGCCTATGCGGGGCCGGCCCAGAGC CTGGGCTCCTTCGTGCACTGCGAGCCCTGCGACGAGAAAGCCCTCTCCATGTGCCCCCCC AGCCCCCTGGGCTGCGAGCTGGTCAAGGAGCCGGGCTGCGGCTGCTGCATGACCTGCGCC CTGGCCGAGGGGCAGTCGTGCGGCGTCTACACCGAGCGCTGCGCCCAGGGGCTGCGCTGC CTCCCCCGGCAGGACGAGGAGAAGCCGCTGCACGCCCTGCTGCACGGCCGCGGGGTTTGC CTCAACGAAAAGAGCTACCGCGAGCAAGTCAAGATCGAGAGAGACTCCCGTGAGCACGAG GAGCCCACCACCTCTGAGATGGCCGAGGAGACCTACTCCCCCAAGATCTTCCGGCCCAAA CACACCCGCATCTCCGAGCTGAAGGCTGAAGCAGTGAAGAAGGACCGCAGAAAGAAGCTG ACCCAGTCCAAGTTTGTCGGGGGAGCCGAGAACACTGCCCACCCCCGGATCATCTCTGCA CCTGAGATGAGACAGGAGTCTGAGCAGGGCCCCTGCCGCAGACACATGGAGGCTTCCCTG CAGGAGCTCAAAGCCAGCCCACGCATGGTGCCCCGTGCTGTGTACCTGCCCAATTGTGAC CGCAAAGGATTCTACAAGAGAAAGCAGTGCAAACCTTCCCGTGGCCGCAAGCGTGGCATC TGCTGGTGCGTGGACAAGTACGGGATGAAGCTGCCAGGCATGGAGTACGTTGACGGGGAC TTTCAGTGCCACACCTTCGACAGCAGCAACGTTGAGTGA
GenBank Gene ID
GeneCard ID	None
GenAtlas ID
HGNC ID	HGNC:5474
Chromosome Location	2
Locus	None
References	Kiefer MC, Ioh RS, Bauer DM, Zapf J: Molecular cloning of a new human insulin-like growth factor binding protein. Biochem Biophys Res Commun. 1991 Apr 15;176(1):219-25.[1850258 ] Shimasaki S, Shimonaka M, Zhang HP, Ling N: Identification of five different insulin-like growth factor binding proteins (IGFBPs) from adult rat serum and molecular cloning of a novel IGFBP-5 in rat and human. J Biol Chem. 1991 Jun 5;266(16):10646-53.[1709938 ] Allander SV, Larsson C, Ehrenborg E, Suwanichkul A, Weber G, Morris SL, Bajalica S, Kiefer MC, Luthman H, Powell DR: Characterization of the chromosomal gene and promoter for human insulin-like growth factor binding protein-5. J Biol Chem. 1994 Apr 8;269(14):10891-8.[7511611 ] Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7.[15489334 ] Andress DL, Birnbaum RS: A novel human insulin-like growth factor binding protein secreted by osteoblast-like cells. Biochem Biophys Res Commun. 1991 Apr 15;176(1):213-8.[1850257 ] Standker L, Wobst P, Mark S, Forssmann WG: Isolation and characterization of circulating 13-kDa C-terminal fragments of human insulin-like growth factor binding protein-5. FEBS Lett. 1998 Dec 18;441(2):281-6.[9883900 ] Nili M, Mukherjee A, Shinde U, David L, Rotwein P: Defining the disulfide bonds of insulin-like growth factor-binding protein-5 by tandem mass spectrometry with electron transfer dissociation and collision-induced dissociation. J Biol Chem. 2012 Jan 6;287(2):1510-9. doi: 10.1074/jbc.M111.285528. Epub 2011 Nov 22.[22117064 ] Tagliabracci VS, Wiley SE, Guo X, Kinch LN, Durrant E, Wen J, Xiao J, Cui J, Nguyen KB, Engel JL, Coon JJ, Grishin N, Pinna LA, Pagliarini DJ, Dixon JE: A Single Kinase Generates the Majority of the Secreted Phosphoproteome. Cell. 2015 Jun 18;161(7):1619-32. doi: 10.1016/j.cell.2015.05.028.[26091039 ] Kalus W, Zweckstetter M, Renner C, Sanchez Y, Georgescu J, Grol M, Demuth D, Schumacher R, Dony C, Lang K, Holak TA: Structure of the IGF-binding domain of the insulin-like growth factor-binding protein-5 (IGFBP-5): implications for IGF and IGF-I receptor interactions. EMBO J. 1998 Nov 16;17(22):6558-72.[9822601 ]

From www.t3db.ca